Identifiers and Description

Gene Model Identifier

TTHERM_00474920

Standard Name

RIB1 (Conjugation-specific Mediator complex-associated protein Rib1 (Ripe Banana 1))

Aliases

PreTt02291 | 57.m00230 | 3709.m00090

Description

Conjugation-specific Mediator complex-associated protein required for the production of scnRNAs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00474920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13168.12.0004286606204839e-16hypothetical protein (554 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280995: Tian M, Mochizuki K, Loidl J (2019) Non-coding RNA Transcription in Tetrahymena Meiotic Nuclei Requires Dedicated Mediator Complex-Associated Proteins. Current biology : CB ( ):
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00474920(coding)
ATGCAAGAAACAAATAATTTGTAGTAGATCTTGAGTTCAAATAACACCAAAAAGCCTAAT
AATCCTCAGTCTTAACAGTAAATCTAGAGCACCTCTTAGTTTTTCAACAAGAACAGGTAA
AACAACAATAAGAATCTTAAAAACAATAACAGCTAGAATCCTTACTATAGAGGCGAGAAC
AATCCAGCAGGCTAGTCATAAATAGATAAGGAAGTCAACATGATGCCTGAGTCTGGTTAT
TAAAATTCTAATTAGATTAATACAAATTATAACTAGATAAATTAGAATTAGATGAACCAA
AATCCAAACTAGATCAATCAAAATCCTAATTAAATGAACTAAAACCAAAATCAGATGAAC
TAGAATCAAAATCCGATGAACTAGAATTAAAATTAAATGAATTAGAATCCTAATTAGATG
AACTAAATTCCTGGCTAGAATCCAAATTTTAATATAAATGCTCCTCATGGCTAGAATCCT
CAAAGAAGAAACTACTCTTATAAATTCTAAAAGGACTATTGTAGACCTTAAATGAATATG
CAAAACAACTTTTAAAGCTATCCCAATAACAGAAATTACGAAAATAATATGAATCCTACT
AGAGGAGAATTTTTCTAGGGCTATTCAAATCCTCCTTAGCAAAACCATTTCAATTAGTAA
AAGTTTTAACCTTAATATTAGGGTTAACATTATTACGATAATCAGTATATGCAGAATAAG
TTCTACTAAAATCAAAATTACGAAAATCAAGCTTAAAGCAAAAACTAAGACAACCCTAAT
AGATCTAATACTGATAAAGAAAGATACTTCGATTAAGATAGAAAGATCAAGTAAATTGTA
GAACAAGTGGTTGAGTAAGTTATTGAACAAAAATTTTAGGAAAAGGAGGATATTTTCAGG
GAAAAGCTCTAAGAAAAGGATGACATTATTACTGATTTACTAGAAAAACTTAAAATAAGA
ACAGAAGACAATACTTAGAACACTGTTTCGACTGCTAAATTTGAAAAATAAGTCATTTAA
TCTGAAATATATCCTGAAATTCATTAAGAAATTTTAGAAAAGAAAAACCAGGATAGACAA
CGTGCCCGTACTCCTAAACGTAGCTAGTACAATTATGACATGCATTCGGAGAGATCAAGA
ACTGTAGAGTCCAAATGCTAGGAATCAAAAGATTAAATAACACCTAAGATAGGGAACAAA
ATGCAGAAATCAGATGCCATGAGCACTTTAAAATCCTAAGATATCACTTTCTGTTGTGAA
AATATCCAAAGCTGA


>TTHERM_00474920(protein)
MQETNNLQQILSSNNTKKPNNPQSQQQIQSTSQFFNKNRQNNNKNLKNNNSQNPYYRGEN
NPAGQSQIDKEVNMMPESGYQNSNQINTNYNQINQNQMNQNPNQINQNPNQMNQNQNQMN
QNQNPMNQNQNQMNQNPNQMNQIPGQNPNFNINAPHGQNPQRRNYSYKFQKDYCRPQMNM
QNNFQSYPNNRNYENNMNPTRGEFFQGYSNPPQQNHFNQQKFQPQYQGQHYYDNQYMQNK
FYQNQNYENQAQSKNQDNPNRSNTDKERYFDQDRKIKQIVEQVVEQVIEQKFQEKEDIFR
EKLQEKDDIITDLLEKLKIRTEDNTQNTVSTAKFEKQVIQSEIYPEIHQEILEKKNQDRQ
RARTPKRSQYNYDMHSERSRTVESKCQESKDQITPKIGNKMQKSDAMSTLKSQDITFCCE
NIQS


>TTHERM_00474920(gene)
ATGCAAGAAACAAATAATTTGTAGTAGATCTTGAGTTCAAATAACACCAAAAAGCCTAAT
AATCCTCAGTCTTAACAGTAAATCTAGAGCACCTCTTAGTTTTTCAACAAGAACAGGTAA
AACAACAATAAGAATCTTAAAAACAATAACAGCTAGAATCCTTACTATAGAGGCGAGAAC
AATCCAGCAGGCTAGTCATAAATAGATAAGGAAGTCAACATGATGCCTGAGTCTGGTTAT
TAAAATTCTAATTAGATTAATACAAATTATAACTAGATAAATTAGAATTAGATGAACCAA
AATCCAAACTAGATCAATCAAAATCCTAATTAAATGAACTAAAACCAAAATCAGATGAAC
TAGAATCAAAATCCGATGAACTAGAATTAAAATTAAATGAATTAGAATCCTAATTAGATG
AACTAAATTCCTGGCTAGAATCCAAATTTTAATATAAATGCTCCTCATGGCTAGAATCCT
CAAAGAAGAAACTACTCTTATAAATTCTAAAAGGACTATTGTAGACCTTAAATGAATATG
CAAAACAACTTTTAAAGCTATCCCAATAACAGAAATTACGAAAATAATATGAATCCTACT
AGAGGAGAATTTTTCTAGGGCTATTCAAATCCTCCTTAGCAAAACCATTTCAATTAGTAA
AAGTTTTAACCTTAATATTAGGGTTAACATTATTACGATAATCAGTATATGCAGAATAAG
TTCTACTAAAATCAAAATTACGAAAATCAAGCTTAAAGCAAAAACTAAGACAACCCTAAT
AGATCTAATACTGATAAAGAAAGATACTTCGATTAAGATAGAAAGATCAAGTAAATTGTA
GAACAAGTGGTTGAGTAAGTTATTGAACAAAAATTTTAGGAAAAGGAGGATATTTTCAGG
GAAAAGCTCTAAGAAAAGGATGACATTATTACTGATTTACTAGAAAAACTTAAAATAAGA
ACAGAAGACAATACTTAGAACACTGTTTCGACTGCTAAATTTGAAAAATAAGTCATTTAA
TCTGAAATATATCCTGAAATTCATTAAGAAATTTTAGAAAAGAAAAACCAGGATAGACAA
CGTGCCCGTACTCCTAAACGTAGCTAGTACAATTATGACATGCATTCGGAGAGATCAAGA
ACTGTAGAGTCCAAATGCTAGGAATCAAAAGATTAAATAACACCTAAGATAGGGAACAAA
ATGCAGAAATCAGATGCCATGAGCACTTTAAAATCCTAAGATATCACTTTCTGTTGTGAA
AATATCCAAAGCTGA