Identifiers and Description

Gene Model Identifier

TTHERM_00161180

Standard Name

RFC5 (Replication factor C 5)

Aliases

PreTt28510 | 13.m00538 | 3829.m01331

Description

Subunit of Replication factor C (RF-C), which acts as a clamp loader of the proliferating cell nuclear antigen (PCNA)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( TIGR00678 ) DNA polymerase III, delta' subunit
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 34.8%

TetraMine Data

TTHERM_00161180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05372.19.997093137033517e-262replication factor C subunit (
359 aa)
DictyBaseDDB_G02937023.0014466598835893e-101rfc3 on chromosome: 6 position
3014705 to 3015924
OxytrichaContig1144.0.g1183.9985196551577655e-99Replication factor C C-termina
l domain
SGDYBR087W2.9986068920536807e-84RFC5 Subunit of heteropentamer
ic Replication factor C (RF-C)
, which is a DNA binding prote
in and ATPase that acts as a c
lamp loader of the proliferati
ng cell nuclear antigen (PCNA)
processivity factor for DNA p
olymerases delta and epsilon
WormBaseWBGene000043399.996373193201036e-79locus:rfc-3 status:Confirmed
UniProt:Q18547 protein_id
:CAA94339.1
Stentor CoeruleusSteCoe_341172.7487850079102147e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161180(protein)
MLRGQFQKIQIIRIILLKIQVLKARDRQTERYINISYSKFFAKKQFISISTKQFKKRFIN
KKILQMEKLWVDEIRPKSLDKLDYHPLLTEKLQKLAHSEDFPHLLLYGPNGAGKKTRAMA
FLQEVYGNGVHKVKSEEREFKVNPNTSTTVEVNIISSNYHLDVTPADAENQDRAVIQKLI
KEVASTHQLDPNSQRRFKVIIINEVDRLTLEAQASLRRTMEKYIGRCRLILIAENIGRVI
LPLRSRCLLIRVAAPSEQDVKAVVRKLNNEKNLNIPDDLACKFAKSCDYNLRAVILNLQT
QKLLKSTYNNSMEVQEPEWKKEIKNIAGIIKEHQNPAKLKEIRSKFYDLLVNCIPGDIII
KNLMYSLLDLIDQNDVHTKQEIIYYAAHHENLMNMGSKPVFHLEAFAAQCMLSYKKSILK
LKD


>TTHERM_00161180(coding)
ATGTTACGCGGTTAATTCCAAAAAATATAAATAATTAGAATTATACTTCTTAAAATCTAA
GTTTTGAAAGCTAGAGACAGGCAAACAGAAAGATATATAAATATTAGCTATTCAAAATTT
TTTGCAAAAAAATAATTTATTTCAATCAGTACAAAACAGTTTAAAAAAAGGTTTATCAAT
AAAAAGATATTATAAATGGAAAAGCTTTGGGTAGACGAAATTAGACCAAAATCACTTGAT
AAGTTAGATTATCATCCTTTGTTAACTGAAAAATTATAAAAGCTAGCTCATTCTGAAGAT
TTCCCTCATTTGTTATTATATGGACCTAATGGTGCAGGTAAAAAAACAAGAGCTATGGCT
TTCTTGCAAGAAGTTTATGGAAATGGTGTGCATAAAGTCAAATCTGAAGAAAGAGAATTT
AAAGTTAATCCAAATACAAGCACTACAGTTGAAGTTAATATAATTTCATCTAATTATCAT
TTAGATGTCACACCTGCTGATGCAGAGAATTAAGATAGAGCAGTCATTTAGAAGTTGATT
AAAGAAGTTGCTTCAACACATTAGTTAGATCCAAATTCTCAAAGACGTTTTAAAGTTATT
ATTATAAACGAAGTAGATCGTCTTACTCTTGAAGCTTAAGCCTCTCTAAGAAGAACTATG
GAAAAATATATTGGCAGATGCAGATTAATTTTGATAGCTGAAAATATTGGAAGAGTTATT
TTACCACTTAGAAGTAGATGCCTATTAATTAGAGTTGCTGCACCCTCAGAGCAAGATGTT
AAAGCTGTTGTTAGAAAGCTTAATAATGAAAAGAATTTAAATATACCTGATGATCTAGCT
TGCAAATTCGCAAAATCATGTGATTATAATTTAAGAGCAGTCATTTTAAATTTGCAAACA
CAAAAGCTACTCAAAAGTACTTACAACAATTCTATGGAGGTATAAGAGCCTGAATGGAAG
AAAGAAATTAAAAATATCGCAGGAATTATCAAAGAGCATTAAAATCCAGCAAAGTTAAAA
GAAATTAGAAGTAAATTTTATGACTTATTGGTAAATTGCATACCAGGAGATATAATTATA
AAGAATTTGATGTACAGTCTTCTTGATTTAATTGACCAAAATGATGTACATACTAAATAA
GAAATCATATACTATGCTGCTCACCATGAGAATTTGATGAATATGGGATCAAAGCCTGTC
TTCCACTTAGAAGCATTTGCTGCATAGTGCATGCTAAGCTACAAGAAATCTATATTAAAA
TTAAAAGATTGA


>TTHERM_00161180(gene)
ATGTTACGCGGTTAATTCCAAAAAATATAAATAATTAGAATTATACTTCTTAAAATCTAA
GTTTTGAAAGCTAGAGACAGGCAAACAGAAAGATATATAAATATTAGCTATTCAAAATTT
TTTGCAAAAAAATAATTTATTTCAATCAGTACAAAACAGTTTAAAAAAAGGTTTATCAAT
AAAAAGATATTATAAATGGAAAAGCTTTGGGTAGACGAAATTAGACCAAAATCACTTGAT
AAGTTAGATTATCATCCTTTGTTAACTGAAAAATTATAAAAGCTAGCTCATTCTGAAGAT
TTCCCTCATTTGTTATTATATGGACCTAATGGTGCAGGTAAAAAAACAAGAGCTATGGCT
TTCTTGCAAGAAGTTTATGGAAATGGTGTGCATAAAGTCAAATCTGAAGAAAGAGAATTT
AAAGTTAATCCAAATACAAGCACTACAGTTGAAGTTAATATAATTTCATCTAATTATCAT
TTAGATGTCACACCTGCTGATGCAGAGAATTAAGATAGAGCAGTCATTTAGAAGTTGATT
AAAGAAGTTGCTTCAACACATTAGTTAGATCCAAATTCTCAAAGACGTTTTAAAGTTATT
ATTATAAACGAAGTAGATCGTCTTACTCTTGAAGCTTAAGCCTCTCTAAGAAGAACTATG
GAAAAATATATTGGCAGATGCAGGTAAAATAATATACCAATCATTATTTAAAAATGAAAT
TTTCTAAAATATTTTGCACAATACAAAAACTCAAACAAAAAAATTCAATCCTAAAAATCT
AAAAAGAATAATTTTATTTTTCATTTCCTAAAATTTATTTTATTAAAATTATTTATTTTA
TAACTAAATAAATCCTAAAACAAATTTCTTTATTGACATAAAAGTAATTACAAATATTTT
GATCAGAAAAGTAGAAATACAAAATATTAAACAAATTAGATATCTATCTTAAAATAATTC
CCATTATATAATACTTAGCATAATAAATATTTTATAAAGTCAATCAAAAACTTAGATGAG
ATTTCTAAATAAAATAAAATTAGATATTCTATGAAGTCAATAATAATGATATCAACAAAT
AATATAAATAGAAGTATAAATAATTATCTGAATTACTATTTGATTTGTATAAAATTAAAA
AGAAACTAGATTAAAAAAATAATTTTTTAATTTTCAAGTTTTGAGAGTTATGATAAAAAT
AAAAGGTTATTTGTTTTAGATAAAAGTAAAATAAATCCTAAATCAAATAACTTTATTAAC
ACAAAAATACTAGCAAATATTTTGATCAGAAAAGTAGAAATAAAAAATATTAAAAAACAT
TTAAATTAGATATTTTATAGTCATCCCATTATGTCATTTTGAGAATAATAAAGATATTTT
AAAGTCAACAAAAACTTAGCTGAGATTTATAAACTAAATTTATTTGGATATTTTAAATTT
GTAAATAATAATAGATATCGAGAAAAACAATAAATAGAAGTTTAAAATAATTATCTGAGT
TATTATTAGCTACATAAAAAATAGTGATAAAAATATTAAGAAGTTAAATATTTTTTTAAA
TAATTTTGAAGAGTTATCATAATTATATAAAGATATAACCCCTTGTTTTTGAACAATAAA
TAAAATAACATAGAAAATATAATTTAGATTATTTATCAAATTAAAAATCAATTTTTTATG
AGTCCTAAAACATAAATCTATAATTCAATAATAATTCAATCAATTCAAATCAAAAAATAT
TATTTTTAATAATAAATTCAATGATAATTATAATTTAAAAAGATAATTTTTTTTTATAAA
ATATTTTATGAGCAATTATTTGATAGTTTTAAGCAAAAATATAATTTATCTTTTTGATTC
ATAAAACAATTATTTGAGTAAAATAAAATTGCATAATTGTTCTTTTTTATATAGGATTTT
TTTCTATAACAAATTTTAATCAGATATTTTCTATAACTTACAAATTCTAAATAAAATTAA
TACTTTTACACTGAATTTAAAACAAGTAACTTATCAATTTTTTATAATATTGATTAATTT
ACAGTTTAAAATGTAAGAGTAAATAACTAACGTGCGATTACTTACTTAATTAATGTATTG
ATTTTTTATATATAGATTAATTTTGATAGCTGAAAATATTGGAAGAGTTATTTTACCACT
TAGAAGTAGATGCCTATTAATTAGAGTTGCTGCACCCTCAGAGCAAGATGTTAAAGCTGT
TGTTAGAAAGCTTAATAATGAAAAGAATTTAAATATACCTGATGATCTAGCTTGCAAATT
CGCAAAATCATGTGATTATAATTTAAGAGCAGTCATTTTAAATTTGCAAACACAAAAGCT
ACTCAAAAGTACTTACAACAATTCTATGGAGGTATAAGAGCCTGAATGGAAGAAAGAAAT
TAAAAATATCGCAGGAATTATCAAAGAGCATTAAAATCCAGCAAAGTAATTTCATCATAT
CTATTAATATAATTTCTAGTTTTAAACAAACACAAAGTTTCAATTCATATTTTATTAAGA
AAGAAACTTATTTGCTAAAATATTTCCATAAAATAAATATTTTGATCATTTAATTTTAAT
CGGAATCATAAAAAATATTTCGTATTAAGTATTCTTCAAAAAAGTAACAGATATATTTTT
AGAGAAACCTTAAACCTTTAGATATTAGACCATTATTAGATAAATTGATTGAGCTATTTA
ATTTAATTCGATAAAGTTAATGAATTACATAGATTAATTCAATCTTTGTTTGATCAAAAT
AAAATTTTGCTTATTATCAACACATAGTTAGTTATTTTATTATCAACATCAGCCAATATA
TATTGATCAATTTTTAATCATCTTAACTTAATTTCAAACTTGAAAAACACTAAATCAAAA
ATTTTTATTGTTCACTCATTCAATCACTCTCATACACATTTACTGTTGAAATGTAATATT
TAATTTAAAGCAAGACGTCAGAGTAAATAAAATTTGATCAAGCTTAACTTACTTTTGATT
TAAAAAAATAAAATATTGACACTTTTTATATGAGTTTTATCTAAATAAATTAGGTTAAAA
GAAATTAGAAGTAAATTTTATGACTTATTGGTAAATTGCATACCAGGAGATATAATTATA
AAGAATTTGATGTACAGTCTTCTTGATTTAATTGACCAAAATGATGTACATACTAAATAA
GAAATCATATACTATGCTGCTCACCATGAGAATTTGATGAATATGGGATCAAAGCCTGTC
TTCCACTTAGAAGCATTTGCTGCATAGTGCATGCTAAGCTACAAGAAATCTATATTAAAA
TTAAAAGATTGA