Identifiers and Description

Gene Model Identifier

TTHERM_00780750

Standard Name

RFC4 (Replication factor C subunit 4)

Aliases

PreTt01287 | 130.m00097 | 3738.m00033

Description

Subunit of Replication factor C (RF-C), which acts as a clamp loader of the proliferating cell nuclear antigen (PCNA)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04548 ) AIG1 family
  • ( PF00004 ) ATPase, AAA family
  • ( PF08542 ) Replication factor C
  • ( TIGR02881 ) stage V sporulation protein K
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF06144 ) DNA polymerase III, delta subunit
  • ( PF08718 ) Glycolipid transfer protein (GLTP)
  • ( TIGR00678 ) DNA polymerase III, delta' subunit
  • ( TIGR02397 ) DNA polymerase III, subunit gamma
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00780750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18674.19.997093137033517e-262ATPase, AAA family protein (32
4 aa)
OxytrichaContig3514.0.g136.996820840887259e-117Replication factor C C-termina
l domain
WormBaseWBGene000043385.001313616964319e-114locus:rfc-2 status:Confirmed
UniProt:O44175 protein_id
:CCD63484.1
DictyBaseDDB_G02918681.9999366565375063e-113rfc2 on chromosome: 6 position
850606 to 851622
SGDYOL094C1.9994050701445255e-104RFC4 Subunit of heteropentamer
ic Replication factor C (RF-C)
, which is a DNA binding prote
in and ATPase that acts as a c
lamp loader of the proliferati
ng cell nuclear antigen (PCNA)
processivity factor for DNA p
olymerases delta and epsilon
Stentor CoeruleusSteCoe_44426.991989996645917e-56

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780750(coding)
ATGGCAAGTAAAGAAATATGGCTTGAGAAGTATCGTCCTCGTACATTAGATGAAGTTTAA
GGTAATGAAGATGCCTTGATCAAGTTAAGAACAATTGCAGAGGAAGGTAACGTCCCAAAT
ATGATATTAGTTGGTCCTCCTGGTATTGGTAAAACTAGTTCAGTACTTTGTTTAGCAAGA
ACACTACTTGCAGATGTATTTGATTCCTGTGCTCTTGAAATGAATGCTTCTGACGAAAGA
GGTATTGATGTTGTCAGAGAAAAAATAAAGAGTTTTGCATAAAAAAAGGTAAATTTAAAG
CCTGGTCTTCATAAAATAATTATTCTTGATGAAGCTGATTCATTAACTGAAGGAGCTTAA
CAGGCTTTAAGAATGATTATTAGTGATTTTGCTGATACTACTAGATTTGTATTAAGTTGT
AATGATAGTTCAAAATTAATTGATGCTATTCAAAGTAGATGTGCTATTTTAAGATTTACT
AAGTTAACTGACGAATAAATATTAAGAAGACTTGAAGAAATTGTAGAAAAAGAAAATATC
AAAATAGATAAGGGAGGTAAAGAAGCTCTACTCTTTACATGTGAAGGAGATATGAGATAA
GCAATTAACAATTTATAAGCTACCTACACTGCTTTCAAACTTGTAAATAAAGAAAATGTC
CTTAAGGTTTGTGATGTCCCAAATGTTGAAGTCCTTTAACAAGTTATTGCAGAATGTGTT
AATGGAAACTTCCATGCTGCTTAAAAGAAACTTTATCCACTATGGGAAGAAGGATATACT
GCTTACGATTTAGTTAACAATTTATATAAACTTATCCAAACTCAAGATATGGATAAATAG
CTTCAATATGAATTTATGAGAGAAATGGCTTTCCTTAAGATGAAAGTTCTTGAAGGCTTG
CCAACATTCTTGCAGATTTCTGGATATCTTGCTAAAATATCTTCTATTGCAAACTCCAAA
AAATGA


>TTHERM_00780750(protein)
MASKEIWLEKYRPRTLDEVQGNEDALIKLRTIAEEGNVPNMILVGPPGIGKTSSVLCLAR
TLLADVFDSCALEMNASDERGIDVVREKIKSFAQKKVNLKPGLHKIIILDEADSLTEGAQ
QALRMIISDFADTTRFVLSCNDSSKLIDAIQSRCAILRFTKLTDEQILRRLEEIVEKENI
KIDKGGKEALLFTCEGDMRQAINNLQATYTAFKLVNKENVLKVCDVPNVEVLQQVIAECV
NGNFHAAQKKLYPLWEEGYTAYDLVNNLYKLIQTQDMDKQLQYEFMREMAFLKMKVLEGL
PTFLQISGYLAKISSIANSKK


>TTHERM_00780750(gene)
ATGGCAAGTAAAGAAATATGGCTTGAGAAGTACTTTTTTAGCATTAATTAGAATTAGCAT
TGAAAATTAATAATTAATTGCTATATTTTAACTGCCATTAAATAAATAATATAATATACT
TATTAGGTATCGTCCTCGTACATTAGATGAAGTTTAAGGTAATGAAGATGCCTTGATCAA
GTTAAGAACAATTGCAGAGGAAGGTAACGTCCCAAATATGATATTAGTTGGTCCTCCTGG
TATTGGTAAAACTAGTTCAGTACTTTGTTTAGCAAGAACACTACTTGCAGATGTATTTGA
TTCCTGTGCTCTTGAAATGAATGCTTCTGACGAAAGAGGTATTGATGTTGTCAGAGAAAA
AATAAAGAGTTTTGCATAAAAAAAGGTAAATTTAAAGCCTGGTCTTCATAAAATAATTAT
TCTTGATGAAGCTGATTCATTAACTGAAGGAGCTTAACAGGTAATTAGGATTATTTTCAT
TTTTTTATTTTCCCTCTCTTTTTTGTTTTTTAAACAAGTGCGCCAAAAGGAAAATGGCTC
TGAGCATTAGAATATTTGATTAATATAAACAAATTAAGAGATAGTTTAATTTTTTTCTTT
ATAATTTATAGGCTTTAAGAATGATTATTAGTGATTTTGCTGATACTACTAGATTTGTAT
TAAGTTGTAATGATAGTTCAAAATTAATTGATGCTATTCAAAGTAGATGTGCTATTTTAA
GATTTACTAAGTTAACTGACGAATAAATATTAAGAAGACTTGAAGAAATTGTAGAAAAAG
AAAATATCAAAATAGATAAGGGAGGTAAAGAAGCTCTACTCTTTACATGTGAAGGAGATA
TGAGATAAGCAATTAACAATTTATAAGCTACCTACACTGCTTTCAAACTTGTAAATAAAG
AAAATGTCCTTAAGGTTTGTGATGTCCCAAATGTTGAAGTCCTTTAACAAGTTATTGCAG
AATGTGTTAATGGAAACTTCCATGCTGCTTAAAAGAAACTTTATCCACTATGGGAAGAAG
GATATACTGCTTACGATTTAGTTAACAATTTATATAAACTTATCCAAACTCAAGATATGG
ATAAATAGCTTCAATATGAATTTATGAGAGAAATGGCTTTCCTTAAGATGAAAGTTCTTG
AAGGCTTGCCAACATTCTTGCAGATTTCTGGATATCTTGCTAAAATATCTTCTATTGCAA
ACTCCAAAAAATGA