Identifiers and Description

Gene Model Identifier

TTHERM_00213600

Standard Name

RFC3 (Replication factor C subunit 3)

Aliases

PreTt13842 | 17.m00449

Description

Subunit of Replication factor C (RF-C), which acts as a clamp loader of the proliferating cell nuclear antigen (PCNA)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF00004 ) ATPase, AAA family
  • ( PF08542 ) Replication factor C
  • ( PF00255 ) glutathione peroxidase
  • ( PF01926 ) GTPase of unknown function
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF06144 ) DNA polymerase III, delta subunit
  • ( TIGR01618 ) phage nucleotide-binding protein
  • ( PF03215 ) Rad17 cell cycle checkpoint protein
  • ( TIGR00678 ) DNA polymerase III, delta' subunit
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR02397 ) DNA polymerase III, subunit gamma
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00213600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16737.19.997093137033517e-262hypothetical protein (345 aa)
OxytrichaContig21432.0.g82.0000857274312427e-108ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02822353.999582750711782e-108rfc5 on chromosome: 3 position
5553806 to 5555127
SGDYNL290W9.001030883757984e-98RFC3 Subunit of heteropentamer
ic Replication factor C (RF-C)
, which is a DNA binding prote
in and ATPase that acts as a c
lamp loader of the proliferati
ng cell nuclear antigen (PCNA)
processivity factor for DNA p
olymerases delta and epsilon
WormBaseWBGene000184095.0014751778710277e-85Probable replication factor C
subunit 5 status:Partially_c
onfirmed UniProt:P34429 pr
otein_id:CCD63451.1
Stentor CoeruleusSteCoe_231894.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00213600(coding)
ATGGAAGAGGAAATACCCATTACAGTTGAAACCAAATAGAAGTAATAGAATATTCCTTGG
GTTGAAAAATACAGACCTGAGAACTTAGATAATGTCATTTCACATGAGTATATTGTTGCA
ACAATTAAGAAATTTATTGAAGAAGATAAGAAGCTTCCTAATTTATTGTTTTATGGACCT
CCAGGAACAGGTAAGACCTCATTAATAGTAGCTTTAGCCAAATAGTTGTATGGAAAGAAT
TATAAATAGCTTGTTTTAGAACTTAACGCTTCTGATGATAGAGGTATTGACGTTGTTAGA
GAACAAATCAAAACTTTTGCAAGTACTGCCAATTTCGGTATGGTTGGAAAAGGAACTAAA
TTAATTATTTTGGATGAAGCAGACTCTATGACAAATCAAGCTCAGTTTGCTTTGAGAAGA
ATTATTGAAAAATACAGCAGCAATGCTAGATTTTGCATGATATGTAATTACGTCTCAAAA
ATTATTCCTGCTCTCCAATCAAGATGCACAAGATTTAAGTTCAAGCATATTCCTTATTAA
GATGCTAAACTTAGAATTGCATAAATTTGCAATGCTGAAAATTTAAAATATAAAAATTCT
GGTATTGAAGCAGTATTCAAGCTTTGCGATGGAGATATGAGAAGAGTTGTAAATATGCTT
CAATCTCTTTCTTTATAAGGATATGGAAGTGATGAATAAGTAGAAATAACTGATGAATTA
GTTTATAAATTTACAGGTAATGCAACACCAAAAGACATTGAAAATATTATTAACACCATG
AATAATAAATCCATTTCAGAATCATATGAAATAATATAGAGTTACTAGGTAGAAAAAGGT
ATCTCCTTATAAGTTATGTTGAAAGAAATAAGTCTTTTTTTGATGAATACCTCATATCCT
AGCTTAGCACTTGAATTTTTAGTTAAAAGATTGGCAGATCTTGAATATAGAATGTCAATT
AACTGTGATGAAAAAGTTTAAACATTATCATTAATAAGTGCCTTCACAGAAGTTCGTTAG
CTTTTAAGAAGACCTTGA


>TTHERM_00213600(protein)
MEEEIPITVETKQKQQNIPWVEKYRPENLDNVISHEYIVATIKKFIEEDKKLPNLLFYGP
PGTGKTSLIVALAKQLYGKNYKQLVLELNASDDRGIDVVREQIKTFASTANFGMVGKGTK
LIILDEADSMTNQAQFALRRIIEKYSSNARFCMICNYVSKIIPALQSRCTRFKFKHIPYQ
DAKLRIAQICNAENLKYKNSGIEAVFKLCDGDMRRVVNMLQSLSLQGYGSDEQVEITDEL
VYKFTGNATPKDIENIINTMNNKSISESYEIIQSYQVEKGISLQVMLKEISLFLMNTSYP
SLALEFLVKRLADLEYRMSINCDEKVQTLSLISAFTEVRQLLRRP


>TTHERM_00213600(gene)
ATGGAAGAGGAAATACCCATTACAGTTGTAAAATAAAGCTAAAGCATTTTTACAAAATTG
TAATTCGTTTGTTTTTTATTAGGAAACCAAATAGAAGTAATAGAATATTCCTTGGGTTGA
AAAATACAGACCTGAGAACTTAGATAATGTCATTTCACATGAGTATATTGTTGCAACAAG
TAAATAAAATTTGAAAGCTAATCAGAATAAATAAGCAAACAACTTTTTTATTACATTTTT
TAATAGTTAAGAAATTTATTGAAGAAGATAAGAAGCTTCCTAATTTATTGTTTTATGGAC
CTCCAGGAACAGGTGATTCATTCATATCAACTTTTTTTGTACAATATATATAAATTATTA
TTATATAAAACAGGTAAGACCTCATTAATAGTAGCTTTAGCCAAATAGTTGTATGGAAAG
AATTATAAATAGCTTGTTTTAGAAGTAATTTAGCTCAATTTATTTTAATTAGTGATAAGG
TTTTATTAAAAAAAGCTTAACGCTTCTGATGATAGAGGTATTGACGTTGTTAGAGAACAA
ATCAAAACTTTTGCAAGTACTGCCAATTTCGGTATGGTTGGGTAAATAAATATTAAAATT
TTATATAGATTTCATTGAAAAATAAATAGCAGAAAGGCATACATGTAGCCTTCAAGAAGT
ACTTGCAAGAATATTAAAATATTTTGAAATAAATTTAAAATTTGATAATAATAATAAAAA
TTAAAAGAAAAGGAACTAAATTAATTATTTTGGATGAAGCAGACTCTATGACAAATCAAG
CTCAGTTTGCTTTGAGAAGAAGTAAAATGAAATAAAAAACTAGTTTATAGGAAAAAATAA
TTATTTTCAATTAATTTATTAGTTATTGAAAAATACAGCAGCAATGCTAGATTTTGCATG
ATATGTAATTACGTCTCAAAAATTATTCCTGCTCTCCAATCAAGATGCACAAGATTTAAG
TTCAAGCATATTCCTTATTAAGATGCTAAACTTAGAATTGCATAAATTTGCAATGCTGAA
AATTTAAAATATAAAAATTCTGGTATTGAAGCAGTATTCAAGCTTTGCGATGGAGATATG
AGAAGAGTTGTAAATATGCTTCAAGTAAATAAAATATTAAAATATGTTAATGGAAATAAT
TTACTTATTTATTTTTTTAAAAACAAAAATAGTCTCTTTCTTTATAAGGATATGGAAGTG
ATGAATAAGTAGAAATAACTGATGAATTAGTTTATAAATTTACAGGTAATGCAACACCAA
AAGACATTGAAAATATTATTAACACCATGAATAATAAATCCATTTCAGAATCATATGAAA
GTAAATTAATTAATTAAATCTGCTTTAAAATAAATTTTATAAAAAATCGAATTATTTATT
AGTAATATAGAGTTACTAGGTAGAAAAAGGTATCTCCTTATAAGTTATGTTGAAAGAAAT
AAGTCTTTTTTTGATGAATACCTCATATCCTAGCTTAGCACTTGAATTTTTAGTTAAAAG
ATTGGCAGATCTTGAATATAGAATGTCAATTAACTGTGATGAAAAAGTTTAAACATTATC
ATTAATAAGTGCCTTCACAGAAGTTCGTTAGCTTTTAAGAAGACCTTGA