Identifiers and Description

Gene Model Identifier

TTHERM_00245150

Standard Name

RFC2 (Replication factor C sububit 2)

Aliases

PreTt02411 | 21.m00242

Description

Subunit of Replication factor C (RF-C), which acts as a clamp loader of the proliferating cell nuclear antigen (PCNA)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00931 ) NB-ARC domain
  • ( PF06068 ) TIP49 C-terminus
  • ( PF00004 ) ATPase, AAA family
  • ( PF08542 ) Replication factor C
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR02902 ) ATP-dependent protease LonB
  • ( PF06144 ) DNA polymerase III, delta subunit
  • ( TIGR00678 ) DNA polymerase III, delta' subunit
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( TIGR02397 ) DNA polymerase III, subunit gamma
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00245150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00630.19.997093137033517e-262ATPase, AAA family protein (37
1 aa)
OxytrichaContig22064.0.g103.998986577109865e-118ATPase family associated with
various cellular activities (A
AA)
DictyBaseDDB_G02860272.999467474389571e-105rfc4 on chromosome: 4 position
3966261 to 3967572
SGDYJR068W2.999180586171967e-98RFC2 Subunit of heteropentamer
ic Replication factor C (RF-C)
, which is a DNA binding prote
in and ATPase that acts as a c
lamp loader of the proliferati
ng cell nuclear antigen (PCNA)
processivity factor for DNA p
olymerases delta and epsilon
WormBaseWBGene000043409.995417076252815e-72locus:rfc-4 Replication fact
or C subunit 4 status:Confir
med UniProt:P53016 protein
_id:CCD63405.1
Stentor CoeruleusSteCoe_48944.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00245150(coding)
ATGTAGGGCAAATTACTATTTAAAGGTTAGGCCGCTCCTAAGGGTGCTGCTGCAGGAGCA
AATACAAAGGATAACAATAGAATGGAAGAAGAAACTAAAACAGAAGAACTTAATAATAAT
TTGCTTCCTTGGGTTGAAAAATATCGTCCTAATAAAATTGAAGAAGTCAGCTACTAAGAG
GAAGTAATAAAGTCTCTCTAAGGTGTTTTATTATCAGGAAATCTACCTCACTTGATTCTA
CATGGACCTCCTGGTACTGGTAAAACTTCAAGTATCCTTGCCTTTGCAAAGCAACTTTAC
GGACCAACTTTTTACAAAGAGAGAATCTTAGAATTAAATGCATCTGATGATAGAGGTATT
CAAATAGTCAGAGATAAAATAAAAAAATTTGCACAATAAGTTGTCTCTAAGAATCCAGAT
AAATCATTTAAATGCCCAAATTTCAAAATTATTATTTTGGACGAAGCAGACTCAATGACT
ACAGAAGCTCAGTCAGCTTTAAGAAGAATCATTGAAGACACCTCTTCAACCACTCGTTTT
TGTATTATCTGTAACTACATTACTAAGATTATAGAACCATTAGGTAGTAGATGTGTCAAA
TTCAGATTTAAACCTATTCCACTTGAAGCTTAAATAACTAAACTAGAAGAAATATGTAAA
ACAGAAGATATTGAATATGAAAAGGAAGCTCTTGAAAAATTAATTAAAATATCAAACGGT
GATTTGAGAAAAAGTGTAAATCTTCTATAATCTGCATCTACTTTGTATGAAAAGGATATT
AAAGTTGAAGTTATTGAAGAAATTTCAGGAAGTATTCCTGACAATTAAGTATAGAAATTA
TATAAACTTCTTATTGGCAAGGATTTTGATAAATTAAAAGAAGGAGTTAAATAGTTCTTA
TACTAAGGGTATTCTCCTGATTAATTACTTTACTAATTCTCAGAGTATATCATTAGTTCT
AAAGATTTCAATGAAGTTAAAAAAGCTAGAATCCTTGAAAAAATTGCATTAGCTGATAAA
GGTTTAAACGAAAGAGCAGACTCTGAGTTGCAAATATTAAACATGTTCTCAAGCTGTCTT
TCTGTTTTACAAAATCCTGATACTGATTTAAAGAAAAAGTGA


>TTHERM_00245150(protein)
MQGKLLFKGQAAPKGAAAGANTKDNNRMEEETKTEELNNNLLPWVEKYRPNKIEEVSYQE
EVIKSLQGVLLSGNLPHLILHGPPGTGKTSSILAFAKQLYGPTFYKERILELNASDDRGI
QIVRDKIKKFAQQVVSKNPDKSFKCPNFKIIILDEADSMTTEAQSALRRIIEDTSSTTRF
CIICNYITKIIEPLGSRCVKFRFKPIPLEAQITKLEEICKTEDIEYEKEALEKLIKISNG
DLRKSVNLLQSASTLYEKDIKVEVIEEISGSIPDNQVQKLYKLLIGKDFDKLKEGVKQFL
YQGYSPDQLLYQFSEYIISSKDFNEVKKARILEKIALADKGLNERADSELQILNMFSSCL
SVLQNPDTDLKKK


>TTHERM_00245150(gene)
ATGTAGGGCAAATTACTATTTAAAGGTTAGGCCGCTCCTAAGGGTGCTGCTGCAGGAGCA
AATACAAAGGATAACAATAGAATGGAAGAAGAAACTAAAACAGAAGAACTTAATAATAAT
TTGCTTCCTTGGGTTGAAAAATAGTAATTAATCAATTATTTTAATTTAGCTTATTTATAA
ATCAAAGATGATTTAACTTAATAAAATAGTCGTCCTAATAAAATTGAAGAAGTCAGCTAC
TAAGAGGAAGTAATAAAGTCTCTCTAAGGTGTTTTATTATCAGGAAATGTAATTTCATAT
TAGTAGCCAGTTTAGTTATTAGAATAAAATTATTTTTTGCTCAAATAAAAAGCTACCTCA
CTTGATTCTACATGGACCTCCTGGTACTGGTAAAACTTCAAGTATCCTTGCCTTTGCAAA
GCAACTTTACGGGTAAATAAATAAATAATCAACATAAAGATGTTAAAAATATTTGCAATC
CAAACACATAGGCTTATAAATAAATATGATTTTATTTTTAATCAATAGACCAACTTTTTA
CAAAGAGAGAATCTTAGAATTAAATGCATCTGATGATAGAGGTATTCAAATAGTCAGAGA
TAAAATAAAAAAATTTGCACAATAAGTTGTCTCTAAGAATCCAGATAAGTAAAATAAAAC
TGATAGCATTAGGTGTAGATTAAATATTTATAATATTTTGGATAAAATAGATCATTTAAA
TGCCCAAATTTCAAAATTATTATTTTGGACGAAGCAGACTCAATGACTACAGAAGCTCAG
TCAGCTTTAAGAAGAATCATTGAAGACACCTCTTCAACCACTCGTTTTTGTATTATCTGT
AACTACATTACTAAGTAAAATAAATTTATTTCAGTTTTTACTAAGCTATTATAAAGATAT
AAAAATTAACTACAGGTTAGCCATATTATTTTACTAATTTGTTATAAAGATATAAAAATT
TACTGCAGAATAGCCATATTATTAAATAGAATATTAAATATTTCAATAAAAATTAATGTA
AATAGGCTAAATATTATTAGGCAATTTAAAATTTTAATCTAAAAATAAGAATTTAAAATA
GAATAAATTATATTAATTAAAAATGAAAAAACTTGTATAAAATAACAATATTTTAAATAA
AAATAACATAATACAATTATGCAGCTATATTTAATATTTTTAACATATTAAATTTTTAAT
AATAAAAGGATTATAGAACCATTAGGTAGTAGATGTGTCAAATTCAGATTTAAACCTATT
CCACTTGAAGCTTAAATAACTAAACTAGAAGAAATATGTAAAACAGAAGATATTGAATAT
GAAAAGGAAGCTCTTGAAAAATTAATTAAAATATCAAACGGTGATTTGAGAAAAAGTGTA
AATCTTCTATAATCTGCATCTACTTTGTATGAAAAGGATATTAAAGTTGAAGTTATTGAA
GAAATTTCAGGAGTAAATTATTTACTTTGTATAAACGTATTAAATTATTTTTAAATAAAA
ATAAAGAGTATTCCTGACAATTAAGTATAGAAATTATATAAACTTCTTATTGGCAAGGAT
TTTGATAAATTAAAAGAAGGAGTTAAATAGTTCTTATACTAAGGGTATTCTCCTGATTAA
TTACTTTACTAATTCTCAGAGTATATCATTAGTTCTAAAGATTTCAATGAAGTTAAAAAA
GCTAGAATCCTTGAAAAAATTGCATTAGCTGATAAAGGTTTAAACGAAAGAGCAGACTCT
GAGTTGCAAATATTAAACATGTTCTCAAGCTGTCTTTCTGTTTTACAAAATCCTGATACT
GATTTAAAGAAAAAGTGA