Identifiers and Description

Gene Model Identifier

TTHERM_00939110

Standard Name

RFC1 (Homolog of Replication factor C subunit 1)

Aliases

PreTt03760 | 170.m00089

Description

BRCA1 C Terminus (BRCT) domain AAA+ ATpase with a BRCT domain at the N-terminus (Cryptosporidium parvum)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03047 ) COMC family
  • ( PF00004 ) ATPase, AAA family
  • ( PF08243 ) SPT2 chromatin protein
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF03215 ) Rad17 cell cycle checkpoint protein
  • ( PF08519 ) Replication factor RFC1 C terminal
  • ( TIGR02397 ) DNA polymerase III, subunit gamma

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00939110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19334.19.997093137033517e-262BRCT domain-containing protein
(1154 aa)
OxytrichaContig2682.0.g451.9999788875029746e-125Replication factor RFC1 C term
inal domain
WormBaseWBGene000043371.999618694399617e-70locus:rfc-1 status:Confirmed
UniProt:Q18841 protein_id
:CAA99812.1
SGDYOR217W7.000846320060671e-65RFC1 Subunit of heteropentamer
ic Replication factor C (RF-C)
, which is a DNA binding prote
in and ATPase that acts as a c
lamp loader of the proliferati
ng cell nuclear antigen (PCNA)
processivity factor for DNA p
olymerases delta and epsilon
DictyBaseDDB_G02859612.998990600740728e-62rfc1 on chromosome: 4 position
3845828 to 3850119
Stentor CoeruleusSteCoe_16807.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00939110(coding)
ATGAAAAAGAATAACTAGTCAAATAGTTTATTGAAATATTTTAGTAAATAAGATACCAAA
ACTGTTAATAATTCGTAAAATTCTTCTAAAGACAAAGACAAAGAAAAAGATTCTAAAGAA
AAAACAAAAGAATCTTCATCTAAAACTTAATACAAATAAACTAAGGAAATAAAGCATGAA
GAACCTAAAAAATAAGAACAAAATAAGAAGCAAAATGAATAAAAGGAAGAAAAAGAAAAA
AGAAATTTTAGTTAAGATATAAAAAATACTCGATCAACTCCCATTAAAAAAGTTTAAGAG
TAGAAAAAAGAAGAAATAAAATCTTCTAAAAATAAAATGAATGTAGAGAATTCAGGAACT
GAAGAATTATCTGCCACTGAAAGTCTAACAGAACCTGCATTAAGCGAAAATGAGGAAAAA
AATAAATCTTCCAATCAAAATAAAGGGAGAAATGTTTCAAGTGATAATAAATAGTAATAA
GCGAAAGACGTAAAAATGAATTAAAGTTAGACAAGATCAAATGATAATAAAAAAGTAGAT
CCCAAGTAATCAAGTAAAAAGCCATAAAAGAAAAATGAGACTGATGACGATGATTACGGT
ATTAATGATGAAGAAGAGGACTTACCCAAAAATAGCAAACAAAAAAAATTAGTATAAGGG
AGCCAAAAAAAAAATAAAATGATAGTTGAAGATGATGATTATGAAGAAAAAGAAGAGGAT
AAAGATGATAAGGAGTTGCATAAGAATAGTAAATCAAAAAGGGTTTTAGTAAAAGGAGGA
TAAAAATAAAATAAAATGATAGATGAAGATGACTATGATGCTGAAGAAGTAGATGATTAT
GTAGAAGTAAAAAAAACTACCAGCAGGACAAAGGCTTTAGAAGAAAAGAATTTAAAAAAA
ATAGAAGAAAATAAACAAAAGTAATAAGTTTCTGCAAAAAAGGATAAAGCTCCTCCTTAA
AAAGATAAAAATAGTTCTAATGGAAATATAGATTCTGATATTTTAGCAGGATAAACAATT
GTTTTTACTGGTGATTTTGATGGAATTTCTAGAGATACTATGTCTAAAATAGTTACAGAT
ATGGGAGCTAAAAATACAGGTAGTGTTAGTGGAAAGACCACATTGCTTGTCCATGGAAGT
GTTTTGGAGGATGGAAGACCTCCTGAATAAGGAAAAAAATACTAAACAGCAAAATAAAAG
GGAACTAAAATTATGAATTAGTCTTAATTTAGTGATTATTTAAAGGATTTAACAGGAAAG
AGTCTAGAAGACTATGCAAATGTTGGTTAAAATGGAAGTAGATTTGATAAATTTGCTGCT
GTGCCTAATAATAACAACAATAATCCTTAAACTCAATAGAAAAAAGACTCTCAACCTTCC
AAAAAAATATTATAACCACTAAACAAACCCAAAGAAGCTACTAAATATGATCCTAAAAGT
AAATAATAAAATTAATAACCGTAAATGGTCATCCATAAGCCTCCTAAATAAGAATAAATT
TGGACAGAAAAGTATGCTCCAAGCAGTATTAACCTATGCATTGGAAACTAAAAGAATTAT
GAAAAAATGATGGAATGGTTGCATGATTGGGTTGAAGTTGTAATAAAGGGTAATAAAAAA
TAAGTTAAAAATTCATTTTTCAACAGAGCTTAGGGGGTACCTGATAATTCAAGTAATGTT
AATGCAAAAGCCTGCTTATTGAGTGGTCCTCCAGGAATAGGAAAAACAACATCAGTAAGA
CTTATAGCTAAGTTTATGGGATATGAAATAAGAGAATGGAATGCTTCGGATGAACGTAAT
AAAAAGAGTGTTAACAATATACTAGGAGACCTTAAATCTAACTCTATTCTAAATTTATTA
AAAAAAAATAATACAAGTGATTAAACAAACAACAAGGCTGATGATGAAGTCGAAGCTAAA
ACAAATAAAAAATTCATAATATTAATGGATGAAGTTGATGGTATGTCTTCTGGAGACAGA
GGTGGTAACCAAGCTCTTATAGATGCTATCAAAAATACAAATGTACCAATCTTTTGTATA
TGTAATGATAGGATGAATCCTAAGATTAGGAGCTTAGCAAATCACTGTTATGATATCAAG
TTTATAAAGCCAGCAAAATAAGATGTTGCAAAATATATGAAAAATGTATGTGAATAAGAA
GGATTTAAAGATGTTGAAATAGAATCATTAGAAGCAATATCAGAAAGGTTTGGAAATGAC
CTCCGTTAAACATTAAATTTTTTGGAAATGCATTTTAAGACGAGCAAGAGATTATAGGGA
ATTAATTCTAAACAACTAAATTCAGGTTAAAAGGATGCCACAGTAATGCTAGATGCATTT
TAGGCCTCAACTTAGTTGATGTAGAGTTTCAAATTCTAAAAAATGACTTTGAGAGAAAGA
ATAGAACTATTCTTTATTGATTATGATTTGATCCCACTATTAGTTCACCAAAATTATCTC
GATACTATCAAACCTAGAGAAGATGCATCTAAAAATAAAAAAAATGATAATTTTAATGTA
AAAGAACTTTAAAATCTAGTAGATGCAACTTCATCTATAGCGTAAAGTGACTTATTAAGT
AAATCTATTAGATAAAGTGGTAATTGGTCATTACTTCCAAATTTTGCTTTTACAAGTTGT
ATCTACCCATGTGATAAAGTTTGTGAAGATAAACCTATATATCCTAGATTCCCTGAATGG
CTTGGTAAGTTTTAAACAACTAAAAAAACAACAAGAGAACTAAGAGAATTCAGAGTATCT
CTCTCAAAAAGTATATCTGGCTCTAGATTTGCTGTAAAGTTTGATTATGTGCCATTTTTA
CTCAAAATTATATTGAGCCATCTAAAGAAAGGAAAAAACTCAGATATAGAGACAGTTTTA
GATTACTTAGAGTATTATAATATAAAACCCTAACACTTAAAGGAACATCTCAATGATTTA
TAATACCCAAAAAATGATTATTATGGTGTTGTATCTAGTGATATAAAGACAAAATTAACA
AAAGAATACAATAAAAGATATTCCGATAGCAGTAACAAAATAAAAACACAAAAAAAGCAA
AGCAAATCAGAACCTTCATAAGGTAAGTATGATAAAAATTTAGATGATGTCGTCTATTCA
GATACAGAAGAGTTATAATTAGATGAAAATGGGGATGTTGTTGAACCTTAGTAAGATGAA
TAAGAAAAGTCAAAGATAAAAAAACAATAATAGAAAAATAAATAAAATAATAAAAGTAAG
GCACCTAAAACTAAAAAACCTAAATCTAAAAAGAGCGGTAGCGATTCACTAACAGAAGAA
ATCAGCGAAGATGAAGATGGTTCAAACAGTTTAAATTAATTCATAGTTGATGACACCGAA
AACGATGATTGA


>TTHERM_00939110(protein)
MKKNNQSNSLLKYFSKQDTKTVNNSQNSSKDKDKEKDSKEKTKESSSKTQYKQTKEIKHE
EPKKQEQNKKQNEQKEEKEKRNFSQDIKNTRSTPIKKVQEQKKEEIKSSKNKMNVENSGT
EELSATESLTEPALSENEEKNKSSNQNKGRNVSSDNKQQQAKDVKMNQSQTRSNDNKKVD
PKQSSKKPQKKNETDDDDYGINDEEEDLPKNSKQKKLVQGSQKKNKMIVEDDDYEEKEED
KDDKELHKNSKSKRVLVKGGQKQNKMIDEDDYDAEEVDDYVEVKKTTSRTKALEEKNLKK
IEENKQKQQVSAKKDKAPPQKDKNSSNGNIDSDILAGQTIVFTGDFDGISRDTMSKIVTD
MGAKNTGSVSGKTTLLVHGSVLEDGRPPEQGKKYQTAKQKGTKIMNQSQFSDYLKDLTGK
SLEDYANVGQNGSRFDKFAAVPNNNNNNPQTQQKKDSQPSKKILQPLNKPKEATKYDPKS
KQQNQQPQMVIHKPPKQEQIWTEKYAPSSINLCIGNQKNYEKMMEWLHDWVEVVIKGNKK
QVKNSFFNRAQGVPDNSSNVNAKACLLSGPPGIGKTTSVRLIAKFMGYEIREWNASDERN
KKSVNNILGDLKSNSILNLLKKNNTSDQTNNKADDEVEAKTNKKFIILMDEVDGMSSGDR
GGNQALIDAIKNTNVPIFCICNDRMNPKIRSLANHCYDIKFIKPAKQDVAKYMKNVCEQE
GFKDVEIESLEAISERFGNDLRQTLNFLEMHFKTSKRLQGINSKQLNSGQKDATVMLDAF
QASTQLMQSFKFQKMTLRERIELFFIDYDLIPLLVHQNYLDTIKPREDASKNKKNDNFNV
KELQNLVDATSSIAQSDLLSKSIRQSGNWSLLPNFAFTSCIYPCDKVCEDKPIYPRFPEW
LGKFQTTKKTTRELREFRVSLSKSISGSRFAVKFDYVPFLLKIILSHLKKGKNSDIETVL
DYLEYYNIKPQHLKEHLNDLQYPKNDYYGVVSSDIKTKLTKEYNKRYSDSSNKIKTQKKQ
SKSEPSQGKYDKNLDDVVYSDTEELQLDENGDVVEPQQDEQEKSKIKKQQQKNKQNNKSK
APKTKKPKSKKSGSDSLTEEISEDEDGSNSLNQFIVDDTENDD


>TTHERM_00939110(gene)
ATGAAAAAGAATAACTAGTCAAATAGTTTATTGAAATATTTTAGTAAATAAGATACCAAA
ACTGTTAATAATTCGTAAAATTCTTCTAAAGACAAAGACAAAGAAAAAGATTCTAAAGAA
AAAACAAAAGAATCTTCATCTAAAACTTAATACAAATAAAGTAAATTATTTTTTTAATGA
TGATATTCTTCTACTATTTTGAAATAAAGCTAAGGAAATAAAGCATGAAGAACCTAAAAA
ATAAGAACAAAATAAGAAGCAAAATGAATAAAAGGAAGAAAAAGAAAAAAGAAATTTTAG
TTAAGATATAAAAAATACTCGATCAACTCCCATTAAAAAAGTTTAAGAGTAGAAAAAAGA
AGAAATAAAATCTTCTAAAAATAAAATGAATGTAGAGAATTCAGGAACTGAAGAATTATC
TGCCACTGAAAGTCTAACAGAACCTGCATTAAGCGAAAATGAGGAAAAAAATAAATCTTC
CAATCAAAATAAAGGGAGAAATGTTTCAAGTGATAATAAATAGTAATAAGCGAAAGACGT
AAAAATGAATTAAAGTTAGACAAGATCAAATGATAATAAAAAAGTAGATCCCAAGTAATC
AAGTAAAAAGCCATAAAAGAAAAATGAGACTGATGACGATGATTACGGTATTAATGATGA
AGAAGAGGACTTACCCAAAAATAGCAAACAAAAAAAATTAGTATAAGGGAGCCAAAAAAA
AAATAAAATGATAGTTGAAGATGATGATTATGAAGAAAAAGAAGAGGATAAAGATGATAA
GGAGTTGCATAAGAATAGTAAATCAAAAAGGGTTTTAGTAAAAGGAGGATAAAAATAAAA
TAAAATGATAGATGAAGATGACTATGATGCTGAAGAAGTAGATGATTATGTAGAAGTAAA
AAAAACTACCAGCAGGACAAAGGCTTTAGAAGAAAAGAATTTAAAAAAAATAGAAGAAAA
TAAACAAAAGTAATAAGTTTCTGCAAAAAAGGATAAAGCTCCTCCTTAAAAAGATAAAAA
TAGTTCTAATGGAAATATAGATTCTGATATTTTAGCAGGATAAACAATTGTTTTTACTGG
TGATTTTGATGGAATTTCTAGAGATACTATGTCTAAAATAGTTACAGATATGGGAGCTAA
AAATACAGGTAGTGTTAGTGGAAAGACCACATTGCTTGTCCATGGAAGTGTTTTGGAGGA
TGGAAGACCTCCTGAATAAGGAAAAAAATACTAAACAGCAAAATAAAAGGGAACTAAAAT
TATGAATTAGTCTTAATTTAGTGATTATTTAAAGGATTTAACAGGAAAGAGTCTAGAAGA
CTATGCAAATGTTGGTTAAAATGGAAGTAGATTTGATAAATTTGCTGCTGTGCCTAATAA
TAACAACAATAATCCTTAAACTCAATAGAAAAAAGACTCTCAACCTTCCAAAAAAATATT
ATAACCACTAAACAAACCCAAAGAAGCTACTAAATATGATCCTAAAAGTAAATAATAAAA
TTAATAACCGTAAATGGTCATCCATAAGCCTCCTAAATAAGAATAAATTTGGACAGAAAA
GTATGCTCCAAGCAGTATTAACCTATGCATTGGAAACTAAAAGAATTATGAAAAAATGAT
GGAATGGTTGCATGATTGGGTTGAAGTTGTAATAAAGGGTAATAAAAAATAAGTTAAAAA
TTCATTTTTCAACAGAGCTTAGGGGGTACCTGATAATTCAAGTAATGTTAATGCAAAAGC
CTGCTTATTGAGTGGTCCTCCAGGAATAGGAAAAACAACATCAGTAAGACTTATAGCTAA
GTTTATGGGATATGAAATAAGAGAATGGAATGCTTCGGATGAACGTAATAAAAAGAGTGT
TAACAATATACTAGGAGACCTTAAATCTAACTCTATTCTAAATTTATTAAAAAAAAATAA
TACAAGTGATTAAACAAACAACAAGGCTGATGATGAAGTCGAAGCTAAAACAAATAAAAA
ATTCATAATATTAATGGATGAAGTTGATGGTATGTCTTCTGGAGACAGAGGTGGTAACCA
AGCTCTTATAGATGCTATCAAAAATACAAATGTACCAATCTTTTGTATATGTAATGATAG
GATGAATCCTAAGATTAGGAGCTTAGCAAATCACTGTTATGATATCAAGTTTATAAAGCC
AGCAAAATAAGATGTTGCAAAATATATGAAAAATGTATGTGAATAAGAAGGATTTAAAGA
TGTTGAAATAGAATCATTAGAAGCAATATCAGAAAGGTTTGGAAATGACCTCCGTTAAAC
ATTAAATTTTTTGGAAATGCATTTTAAGACGAGCAAGAGATTATAGGGAATTAATTCTAA
ACAACTAAATTCAGGTTAAAAGGATGCCACAGTAATGCTAGATGCATTTTAGGCCTCAAC
TTAGTTGATGTAGAGTTTCAAATTCTAAAAAATGACTTTGAGAGAAAGAATAGAACTATT
CTTTATTGATTATGATTTGATCCCACTATTAGTTCACCAAAATTATCTCGATACTATCAA
ACCTAGAGAAGATGCATCTAAAAATAAAAAAAATGATAATTTTAATGTAAAAGAACTTTA
AAATCTAGTAGATGCAACTTCATCTATAGCGTAAAGTGACTTATTAAGTAAATCTATTAG
ATAAAGTGGTAATTGGTCATTACTTCCAAATTTTGCTTTTACAAGTTGTATCTACCCATG
TGATAAAGTTTGTGAAGATAAACCTATATATCCTAGATTCCCTGAATGGCTTGGTAAGTT
TTAAACAACTAAAAAAACAACAAGAGAACTAAGAGAATTCAGAGTATCTCTCTCAAAAAG
TATATCTGGCTCTAGATTTGCTGTAAAGTTTGATTATGTGCCATTTTTACTCAAAATTAT
ATTGAGCCATCTAAAGAAAGGAAAAAACTCAGATATAGAGACAGTTTTAGATTACTTAGA
GTATTATAATATAAAACCCTAACACTTAAAGGAACATCTCAATGATTTATAATACCCAAA
AAATGATTATTATGGTGTTGTATCTAGTGATATAAAGACAAAATTAACAAAAGAATACAA
TAAAAGATATTCCGATAGCAGTAACAAAATAAAAACACAAAAAAAGCAAAGCAAATCAGA
ACCTTCATAAGGTAAGTATGATAAAAATTTAGATGATGTCGTCTATTCAGATACAGAAGA
GTTATAATTAGATGAAAATGGGGATGTTGTTGAACCTTAGTAAGATGAATAAGAAAAGTC
AAAGATAAAAAAACAATAATAGAAAAATAAATAAAATAATAAAAGTAAGGCACCTAAAAC
TAAAAAACCTAAATCTAAAAAGAGCGGTAGCGATTCACTAACAGAAGAAATCAGCGAAGA
TGAAGATGGTTCAAACAGTTTAAATTAATTCATAGTTGATGACACCGAAAACGATGATTG
A