Identifiers and Description

Gene Model Identifier

TTHERM_00106890

Standard Name

RFA1 (Homolog of budding yeast RFA1 and mouse RPA1)

Aliases

PreTt23083 | 7.m00532

Description

Encodes Replication Protein A (RPA). Protein involved in recombination and DNA repair

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF07656 ) KWG Leptospira
  • ( PF07975 ) TFIIH C1-like domain
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF08646 ) Replication factor-A C terminal domain
  • ( TIGR00617 ) replication factor-a protein 1 (rpa1)
  • ( PF04057 ) Replication factor-A protein 1, N-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00106890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00409.19.997093137033517e-262hypothetical protein (659 aa)
OxytrichaContig5713.0.g134.000054831110256e-33Replication factor-A C termina
l domain
SGDYAR007C6.001249495680822e-29RFA1 Subunit of heterotrimeric
Replication Protein A (RPA),
which is a highly conserved si
ngle-stranded DNA binding prot
ein involved in DNA replicatio
n, repair, and recombination
WormBaseWBGene000175461.9993007828132465e-27locus:rpa-1 Probable replica
tion factor A 73 kDa subunit
status:Confirmed UniProt:Q1
9537 protein_id:CCD62042.1
DictyBaseDDB_G02895130.0000000000599805963605737rfa1 on chromosome: 5 position
2891660 to 2893699
Stentor CoeruleusSteCoe_154230.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:20363756: Min B, Collins K (2010) Multiple mechanisms for elongation processivity within the reconstituted tetrahymena telomerase holoenzyme. The Journal of biological chemistry 285(22):16434-43

Sequences

>TTHERM_00106890(coding)
ATGGTTACTCAATTAACAAAAAATGCTATTGATTCTCTAATAAATAGCACTAATCCTGAT
GAATAGTATGTTATTCAAGTTTTAAAAGCTCCTCAATCTGTTGCTGAAAATCTTTTCAAG
ATTTGCATTTCTGATGGCTTTTGCAAATTCAAGAAAGGATATTTCGTTAGTGATGCTGCT
ACCAAATGCCAAGATTTGAAGGATCTCTGTATTATCAAATGCAAAAAATATATTGATGAC
TCAAACCACGATAAGGAAAGAATTATTATCTCTAACTACGAATTAATATATTCTAATATC
TAAGAGCAAATTGGAAAACCAATCGAATACAAATAATACAAGTCAAGTGGATTCTCTAAT
CCAGAAGGATCAACTGTAATTCCCTCATAATACTTGAGCAGAAACGCTTAAATACTTCAA
TAAAATTAAGTTTCTTAACCTAAGCAAATGGTAACTCCTCCAGTTAGCAACATAAATAAG
CCTACTCCTGCTGTAAATAACACATTTGCTTAAAAACCAGCAGTTACAAACTAAAACATT
TAAAGAGTAAACTAGAATCCATAACAAATGAACAAAACTGCACCTGTAAAGCAAAATAAT
AATAATAACAATAATAACAATGGCAACAACAAAAATAATTCTAGTTTGTAGATTTCTACT
GATGGAGATGAGTAAAATTTGGAATACATTAGAAACTTATAGCCAAATGGTTAACCATAA
ACAATCAAAGTTAGAATCACCAAAAAGGGTGATTTGAAAAGCTTTAAGGAAAAGTAAGGA
AAACTCTTTTCAATAGATGTTATTGATAAGTTTGGAGACGAATGTAGTATTTCTTTCTTC
AACGAAATAGCTGAATAGTATGATGGCTTATTTAAAGTAGGTTAAGTTATAGTCTTGAAA
TAATTTTCAGTGAAAGTCAACAATAATCATCAATACAATAAGGGAGATCACACTGTAACT
GTCAATAAAGAGAGTAAAATATTGATATGTCAAGAAGATCCATCTATTCCTATGATCAAA
TTAAATAGATAATTCATTTAAGATATGTAGAATAAATAGAAAGGAGATTTAATCGATTTG
ATTGTTGTTGTAAAGGCAGACACAGAAGTTAAAACCATGATCTTAAAGAAAGATAATTAA
TAATAATCTAAAAGAGACATAATATCATTTGATGAATCTCTAATTGAAACAGAAATCACA
CTCTGGGGAGAAACTGCTAAAGACTATGATGCAAAGTAGGGAGATATCATTGTATTTAAA
GATGCCAAAATAGGTGAATTTAAAGATAAAAAGTAAATTAATATCGGATATGGAACATAA
ATCTTCATGAATCCAGATGAATAACTCTTCCCATAGATCCATGATGTCAAAAAATGGTAC
CTAAGCTTAAATTCCGACTAATTAAGCACTATTCAAAAGGCATAAGGAAATGATACTGGT
CCTAGAGAAGTAACTAGCTTTGAATCTTCTCTAAACATTTTGAAAGAAGAAATTAAAAAC
CTTTAAACTGACCCAGAAATGAAAATTTGGAAAGAAATTCGTGGTTAAATTATGTACATT
AAAGATACTCCTCTTTATTATAATGCTTGTTTTAGTTGCAAAAAGAAAATCGCACGTAAT
AACGAAGTATGGACTTGCATAAATTGCAATAAAGATTTTAATGAACCTGACTCTAGATAT
ATTCTCTCCCTCAATATAAGTGACTCTACAGATACTATTTGGGTAAGTGCATTCGATGAA
GTAGGTCAAAAAATTCTTGGTAAATTTATTTTTTAAAAGTTAAACTAAGTTAATTTATTT
TTATCATATTTAATTAACTTATTAATTAAACAGGTGTTAAGGGTGATGTATTTAGATATG
CTGATGAAGATACAGAACACGGTACAGAAACAAAAAAGAAATTGCTTATGGCTGCCTAAA
ATAAGGAATATAGATTCCTGTTACTTACTAAATAAGAAAGAGACTAAAATGGCAACGCCA
GAGATAAGACAGTTATTCATGCTATAAAAGACTTTTAACCTGCTTATGAGGCCAAAAAGA
TCATCAATTCTTTGGAGAAATTTATGGTGA


>TTHERM_00106890(protein)
MVTQLTKNAIDSLINSTNPDEQYVIQVLKAPQSVAENLFKICISDGFCKFKKGYFVSDAA
TKCQDLKDLCIIKCKKYIDDSNHDKERIIISNYELIYSNIQEQIGKPIEYKQYKSSGFSN
PEGSTVIPSQYLSRNAQILQQNQVSQPKQMVTPPVSNINKPTPAVNNTFAQKPAVTNQNI
QRVNQNPQQMNKTAPVKQNNNNNNNNNGNNKNNSSLQISTDGDEQNLEYIRNLQPNGQPQ
TIKVRITKKGDLKSFKEKQGKLFSIDVIDKFGDECSISFFNEIAEQYDGLFKVGQVIVLK
QFSVKVNNNHQYNKGDHTVTVNKESKILICQEDPSIPMIKLNRQFIQDMQNKQKGDLIDL
IVVVKADTEVKTMILKKDNQQQSKRDIISFDESLIETEITLWGETAKDYDAKQGDIIVFK
DAKIGEFKDKKQINIGYGTQIFMNPDEQLFPQIHDVKKWYLSLNSDQLSTIQKAQGNDTG
PREVTSFESSLNILKEEIKNLQTDPEMKIWKEIRGQIMYIKDTPLYYNACFSCKKKIARN
NEVWTCINCNKDFNEPDSRYILSLNISDSTDTIWVSAFDEVGQKILGKFIFQKLNQVNLF
LSYLINLLIKQVLRVMYLDMLMKIQNTVQKQKRNCLWLPKIRNIDSCYLLNKKETKMATP
EIRQLFMLQKTFNLLMRPKRSSILWRNLW


>TTHERM_00106890(gene)
ATGGTTACTCAATTAACAAAAAATGCTATTGATTCTCTAATAAATAGCACTAATCCTGAT
GAATAGTATGTTATTCAAGTTTTAAAAGCTCCTCAATCTGTTGCTGAAAATCTTTTCAAG
TAATTTAATTGATTGATCGATTGAAAAAAACTAATTTTATTCATTTCTTTTTTTTGTTGA
CAAATAGGATTTGCATTTCTGATGGCTTTTGCAAATTCAAGAAAGGATATTTCGTTAGTG
ATGCTGCTACCAAATGCCAAGATTGTAATTAATTTTTCTTAATTTTTTGTGAAGAATTGT
ATATGGAAAAGTACTATCATTTTTAACTCTACTTTAATAATTTAATAGTGAAGGATCTCT
GTATTATCAAATGCAAAAAATATATTGATGACTCAAACCACGATAAGGAAAGAATTATTA
TCTCTAACTACGAATTAATATATTCTAATATCTAAGAGCAAATTGGAAAACCAATCGAAT
ACAAATAATACAAGTCAAGTGTAATAAAATATTTCTAAAGTTCTATATAATTTATTTTAT
TCTTTGCTACTTGATCAAAAATGCTCTTTAAAGGGAGTTTTCAAGATATGGCAAAAAAAT
AAAAATATGTTCTTGAAAATTAATAATTTTTAAATTAAATATAAAAGGGATTCTCTAATC
CAGAAGGATCAACTGTAATTCCCTCATAATACTTGAGCAGAAACGCTTAAATACTTCAAT
AAAATTAAGTTTCTTAACCTAAGCAAATGGTAACTCCTCCAGTTAGCAACATAAATAAGC
CTACTCCTGCTGTAAATAACACATTTGCTTAAAAACCAGCAGTTACAAACTAAAACATTT
AAAGAGTAAACTAGAATCCATAACAAATGAACAAAACTGCACCTGTAAAGCAAAATAATA
ATAATAACAATAATAACAATGGCAACAACAAAAATAATTCTAGTTTGTAGATTTCTACTG
ATGGAGATGAGTAAAATTTGGAATACATTAGAAACTTATAGCCAAATGGTTAACCATAAA
CAATCAAAGTTAGAATCACCAAAAAGGGTGATTTGAAAAGCTTTAAGGAAAAGTAAGGAA
AACTCTTTTCAATAGATGTTATTGATAAGTTTGGAGACGAATGTAGTATTTCTTTCTTCA
ACGAAATAGCTGAATAGTATGATGGCTTATTTAAAGTAGGTTAAGTTATAGTCTTGAAAT
AATTTTCAGTGAAAGTCAACAATAATCATCAATAGTAAATTAATTTATTTAAGTTTTAGC
AATTACTATTACATAATATTTAATAAATAGCAATAAGGGAGATCACACTGTAACTGTCAA
TAAAGAGAGTAAAATATTGATATGTCAAGAAGATCCATCTATTCCTATGATCAAATTAAA
TAGATAATTCATTTAAGATATGTAGAATAAATAGAAAGGAGATTTAATCGATTTGATTGT
TGTTGTAAAGGCAGACACAGAAGTTAAAACCATGATCTTAAAGAAAGATAATTAATAATA
ATCTAAAAGAGACATAATATCATTTGATGAATCTCTAATTGAAACAGAAATCACACTCTG
GGGAGAAACTGCTAAAGACTATGATGCAAAGTAGGGAGATATCATTGTATTTAAAGATGC
CAAAATAGGTGAATTTAAAGATAAAAAGTAAATTAATATCGGATATGGAACATAAATCTT
CATGAATCCAGATGAATAACTCTTCCCATAGATCCATGATGTCAAAAAATGGTACCTAAG
CTTAAATTCCGACTAATTAAGCACTATTCAAAAGGCATAAGGAAATGATACTGGTCCTAG
AGAAGTAACTAGCTTTGAATCTTCTCTAAACATTTTGAAAGAAGAAATTAAAAACCTTTA
AACTGACCCAGAAATGAAAATTTGGAAAGAAATTCGTGGTTAAATTATGTACATTAAAGA
TACTCCTCTTTATTATAATGCTTGTTTTAGTTGCAAAAAGAAAATCGCACGTAATAACGA
AGTATGGACTTGCATAAATTGCAATAAAGATTTTAATGAAGTAATATTTTTTCTTATTCA
TCTTTAAAATTTTAGTTAATAAAATTAATTTTATTAAAATATAATTGAATTTATTTTAAA
TAATAATTTTATTAGCCTGACTCTAGATATATTCTCTCCCTCAATATAAGTGACTCTACA
GATACTATTTGGGTAAGTGCATTCGATGAAGTAGGTCAAAAAATTCTTGGTAAATTTATT
TTTTAAAAGTTAAACTAAGTTAATTTATTTTTATCATATTTAATTAACTTATTAATTAAA
CAGGTGTTAAGGGTGATGTATTTAGATATGCTGATGAAGATACAGAACACGGTACAGAAA
CAAAAAAGAAATTGCTTATGGCTGCCTAAAATAAGGAATATAGATTCCTGTTACTTACTA
AATAAGAAAGAGACTAAAATGGCAACGCCAGAGATAAGACAGTTATTCATGCTATAAAAG
ACTTTTAACCTGCTTATGAGGCCAAAAAGATCATCAATTCTTTGGAGAAATTTATGGTGA