Identifiers and Description

Gene Model Identifier

TTHERM_00008800

Standard Name

REX4 (RNA exonuclease REX4)

Aliases

PreTt11690 | 1.m00738

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00008800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02853.16.001622120184464e-159exonuclease (374 aa)
SGDYOL080C3.998097515166115e-39REX4 Putative RNA exonuclease
possibly involved in pre-rRNA
processing and ribosome assemb
ly
OxytrichaContig15694.0.g121.0000633497921574e-36Exonuclease
WormBaseWBGene000124652.998800627344286e-26status:Confirmed UniProt:Q9X
XI3 protein_id:CAA19458.1
DictyBaseDDB_G02915902.000769134519826e-18rexo1 on chromosome: 6 positio
n 580025 to 582109
Stentor CoeruleusSteCoe_190450.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00008800(coding)
ATGGTTGACTAAGTAGAAGATTTAGAATTAATCAAAAAGGAGAAAGATTCTTAATTAAAG
ATACTTGAATCCCTTGATTTTAGTTGTTACAACTCTAATAAAGATGATTTAGAAGAGCAA
TTTGGTGGATAGGTGAAAAAAAAGTTCAAAAATTAATTTGGAGATGCCAAAAATGTTCAT
TAGAAAGATAGAAAATTTAATAAAGTTTAGAAAACTGAATAGAAAAATGAATAATAAACA
GATGAATAATAGAAAGATAATCAGGAAAATGGGGAAGAAGTAAAATAATAGAAATAAATT
AGAAATGTAAAATAAAAAGCTCCATAGGAAGTTTCTAGTAATTGGAAAAAGTTTATGAGT
AGTCAACCTACTCAAAGCAATGACAATGAAGACAATAGCTCTAAAAAATAAATAACCAAT
AAAAAAAGTTAGTCAAGTGAAAGCTCGGGTAATTAATAAAATGTATTTAAGTCCTTAGAA
CCTTAAAAAGATGGATATAAAGGAGTAACTCCCATAGTTGCAATAGATTGTGAAATGGTT
CAGTGCGAAGCTAGCCAAAAAGACGGCTTTCCTACTTAAGAACTGGCTAGAGTATCTATA
GTAAATTATAATGGACATGTTCTTTTAGATACCTATGTAAGACCTCAAAAGAAAATTAAA
AATTATTTGACTAAAGTTAGTGGTATCACATTTACTCACATAAAAAATGCTCCTACTTAT
CCAGAGGTTAAAAACAAAATATTTGAGATACTTAAAGACAAAATTATAGTAGGTCATTCA
GTATAGCATGATTTGAGTTCCATCAAATTTGAGCCTCCCAAAGATAAAATGATCAGAGAT
ATCTCAAATTATAAAGAACTTAAGTAATCAGGAAAAAAGGTTTCTCTTAAAAAGATGGTT
AAATAAGAATTAGGAATTACCTTCCAAGAAGGCTCTCACGACTCTATTTCTGATGCAAGA
GCAGCTTTGTTGATATATAAAAAATATTAAAAGCAAATAGACTAAGAACAAGGCAAGAAA
TGA


>TTHERM_00008800(protein)
MVDQVEDLELIKKEKDSQLKILESLDFSCYNSNKDDLEEQFGGQVKKKFKNQFGDAKNVH
QKDRKFNKVQKTEQKNEQQTDEQQKDNQENGEEVKQQKQIRNVKQKAPQEVSSNWKKFMS
SQPTQSNDNEDNSSKKQITNKKSQSSESSGNQQNVFKSLEPQKDGYKGVTPIVAIDCEMV
QCEASQKDGFPTQELARVSIVNYNGHVLLDTYVRPQKKIKNYLTKVSGITFTHIKNAPTY
PEVKNKIFEILKDKIIVGHSVQHDLSSIKFEPPKDKMIRDISNYKELKQSGKKVSLKKMV
KQELGITFQEGSHDSISDARAALLIYKKYQKQIDQEQGKK


>TTHERM_00008800(gene)
ATGGTTGACTAAGTAGAAGATTTAGAATTAATCAAAAAGGAGAAAGATTCTTAATTAAAG
ATACTTGAATCCCTTGATTTTAGTTGTTACAACTCTAATAAAGATGATTTAGAAGAGCAA
TTTGGTGGATAGGTGAAAAAAAAGTTCAAAAATTAATTTGGAGATGCCAAAAATGTTCAT
TAGAAAGATAGAAAATTTAATAAAGTTTAGAAAACTGAATAGAAAAATGAATAATAAACA
GATGAATAATAGAAAGATAATCAGGAAAATGGGGAAGAAGTAAAATAATAGAAATAAATT
AGAAATGTAAAATAAAAAGCTCCATAGGAAGTTTCTAGTAATTGGAAAAAGTTTATGAGT
AGTCAACCTACTCAAAGCAATGACAATGAAGACAATAGCTCTAAAAAATAAATAACCAAT
AAAAAAAGTTAGTCAAGTGAAAGCTCGGGTAATTAATAAAATGTATTTAAGTCCTTAGAA
CCTTAAAAAGATGGATATAAAGGAGTAACTCCCATAGTTGCAATAGATTGTGAAATGGTT
CAGTGCGAAGCTAGCCAAAAAGACGGCTTTCCTACTTAAGAACTGGCTAGAGTATCTATA
GTAAATTATAATGGACATGTTCTTTTAGATACCTATGTAAGACCTCAAAAGAAAATTAAA
AATTATTTGACTAAAGTTAGTGGTATCACATTTACTCACATAAAAAATGCTCCTACTTAT
CCAGAGGTTAAAAACAAAATATTTGAGATACTTAAAGACAAAATTATAGTAGGTCATTCA
GTATAGCATGATTTGAGTTCCATCAAATTTGAGCCTCCCAAAGATAAAATGATCAGAGAT
ATCTCAAATTATAAAGAACTTAAGTAATCAGGAAAAAAGGTTTCTCTTAAAAAGATGGTT
AAATAAGAATTAGGAATTACCTTCCAAGAAGGCTCTCACGACTCTATTTCTGATGCAAGA
GCAGCTTTGTTGATATATAAAAAATATTAAAAGCAAATAGACTAAGAACAAGGCAAGAAA
TGA