Identifiers and Description

Gene Model Identifier

TTHERM_00112610

Standard Name

REX2 (RNA exonuclease REX2)

Aliases

PreTt27075 | 8.m00335 | 3812.m02373

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00112610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03952.13.9998808708412595e-103exonuclease (228 aa)
OxytrichaContig10568.0.g838.001227934218267e-54Exonuclease
WormBaseWBGene000074295.0020095550341075e-51Probable oligoribonuclease s
tatus:Confirmed UniProt:Q178
19 protein_id:CAA96590.1
DictyBaseDDB_G02733552.000214949834694e-50rexo2-1 on chromosome: 2 posit
ion 2683400 to 2684488
SGDYLR059C3.999458587140588e-43REX2 3-5 RNA exonuclease; invo
lved in 3-end processing of U4
and U5 snRNAs, 5S and 5.8S rR
NAs, and RNase P and RNase MRP
RNA; localized to mitochondri
a and null suppresses escape o
f mtDNA to nucleus in yme1 yme
2 mutants; RNase D exonuclease
Stentor CoeruleusSteCoe_334462.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112610(coding)
ATGGATAGTTAAGAGTAAAAAATTAAGTTGAAGGATCCTCTTTTATGGTGTGATTGTGAA
ATGACTGGTTTAAATTTTTTGAATAATGATTAAATTATAGAAATAGCAACTCTTTTAACT
GATGGTGAATTGACTTAAGTCATCAAAGGTCCTGAGTTAATTATCTAAGCCCCAAAAGAA
CTACTTGAATCTATGGACGAATGGTGCACAAACACTCATAAAGGCAGTGGATTATATGAC
AAAGTTTTAAAAAGTGAAGTCACTTTATAGATGGCTGAAGAATAAGTTATTAAATTTTTA
AAAGATAATGGAATTGAATAAAAAGAAGCTTTATTGGCAGGAAATTCTATACACGCAGAT
ATGAAATTCATTTAAAAATAAATGCCTAACCTTTATAATTTTTTGCATTACAGACTTGTA
GACGTTTCAACTGTAAAGGAGCTAACCAAGAGATGGAATCCCGAAATATTAAAAAAGGCA
CCTGTCAAAAAAGGCGGACATAGAGCTCTAGACGATATTCTTGAAAGCATAGAAGAGTTA
AAATTTTACAGAAAAGAAGTTTTTAAGATTTGA


>TTHERM_00112610(protein)
MDSQEQKIKLKDPLLWCDCEMTGLNFLNNDQIIEIATLLTDGELTQVIKGPELIIQAPKE
LLESMDEWCTNTHKGSGLYDKVLKSEVTLQMAEEQVIKFLKDNGIEQKEALLAGNSIHAD
MKFIQKQMPNLYNFLHYRLVDVSTVKELTKRWNPEILKKAPVKKGGHRALDDILESIEEL
KFYRKEVFKI


>TTHERM_00112610(gene)
ATGGATAGTTAAGAGTAAAAAATTAAGTTGAAGGATCCTCTTTTATGGTGTGATTGTGAA
ATGACTGGTTTAAATTTTTTGAATAATGATTAAATTATAGAAATAGCAACTCTTTTAACT
GATGGTGAATTGACTTAAGTCATCAAAGGTCCTGAGTTAATTATCTAAGCCCCAAAAGAA
CTACTTGAATCTATGGACGAATGGTGCACAAACACTCATAAAGGCAGTGGATTATATGAC
AAAGTTTTAAAAAGTGAAGTCACTTTATAGATGGCTGAAGAATAAGTTATTAAATTTTTA
AAAGATAATGGAATTGAATAAAAAGAAGCTTTATTGGCAGGAAATTCTATACACGCAGAT
ATGAAATTCATTTAAAAATAAATGCCTAACCTTTATAATTTTTTGCATTACAGACTTGTA
GACGTTTCAACTGTAAAGGAGCTAACCAAGAGATGGAATCCCGAAATATTAAAAAAGGCA
CCTGTCAAAAAAGGCGGACATAGAGCTCTAGACGATATTCTTGAAAGCATAGAAGAGTTA
AAATTTTACAGAAAAGAAGTTTTTAAGATTTGA