Identifiers and Description

Gene Model Identifier

TTHERM_00421200

Standard Name

REX1 (RNA exonuclease REX1)

Aliases

PreTt07244 | 46.m00299 | 3679.m00149 | RNH70

Description

exonuclease family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00421200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10952.19.997093137033517e-262exonuclease (584 aa)
SGDYGR276C1.9994920269952867e-34RNH70 3-5 exoribonuclease; req
uired for maturation of 3 ends
of 5S rRNA and tRNA-Arg3 from
dicistronic transcripts
DictyBaseDDB_G02915909.99723014177113e-33rexo1 on chromosome: 6 positio
n 580025 to 582109
WormBaseWBGene000154622.0008113830639685e-30status:Confirmed UniProt:O16
312 protein_id:CCD63091.1
OxytrichaContig22416.0.g982.000769134519826e-18Exonuclease
Stentor CoeruleusSteCoe_361010.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421200(coding)
ATGGAAAAACCAAGCTAATAAGGAACATATGTTTCAATATTCTAGTAACTACAAAGCTAA
AAAAGCTAGACAACAGGAAGCTCATCAATATTTAGTGGCTTAATGAAAACATAGTCTAGT
GATATTATATAAACATCTTCATAAAAGTCTAGCAAAAAAAATAAAAAACCTAACTTATAA
GATTTAGAATAAAGCTCAACTACTCTGAAAAAGATACAAACTAGTTAAGATCAGGCACCA
AAAGATGAATGTGAAATATCTTAGGAATCAATCAATAATAAATAAACAAGCAAATAGGAG
ATAAAAAATAAAATTGAAATAGTTGATCATGCTAAACCCCGCAAATAAACATCAACAAGA
GTATTTTAAAGTTTACTGTAATGGTTATTTACTAAATAAGGAATAAATCCACTTTGGATT
ATGATAGAAGATAGACACCTAATTTAGAATTTTGTATATATTACATTAACTGTACCTCCT
GATTTTGAAAAGCGCTTGTTAGCTAAATAGGATTTTCCTTTTTTAGGTTAATATTATGAT
TAGAAAAATATTGCAGTTTTTAAAGAAAGAACAGTTCAAAATGAAGATAATTATTGGCAT
TCCCTATTCTAAACAAAGTTAACAGAAGATATTTCTCTTCCACTCTTTAACAAAAATACA
GTCTCTCCCTAATAATAAATAAACTAAGAGTAGTATTAAGCAATGACTTATGAAGAAAAA
CTATATTATAAATATTCATAATTTTGTCATTCTAAATAGACTCTTAAGAATAATTTGTAT
CCTACTGAGAGTGAAGACTTTCCTAATTATGTTAGCTCAACTGAGAGTACATTAAAATTT
GACACAGTTAAATTTGAAAACAAAATTCTTGGATTAGATTGTGAAATGGTTTCAACTGAG
TATGGTTTAGAGCTTGCAAGAATAAGTTTAGTTAATTTCGATGGTGAAGTTTTGATAGAC
TAACTGGTAAAAACGCCAAATAGGATTATAAATTATAACACTTAATATAGTGGAATAACA
TAAGAAATGTTAAAAGATGTAAAAGTAGATTTACAGTAAGCACAGAAACTACTATTTTAG
TATGTTTGCTAAGACACCATTCTCATAGGACATTCTTTAGAGAATGATTTAGTAGCTATG
CAAGTAATTCATAACAAGGTTATAGACACAAGTATATTATTTTTGACAAAGAATGAAAGA
AAGCTAAAATTAAAGGATTTGGCCTAAAAATTTTTGAATTGCAAAATTTAGTAAGGTTCT
CACTGTCCTTCAGAAGATGCAAAAAGTGCATTAAGCTTAGCAAAATTGAGAATTGAAATA
TTAGAAAAGTTTGATAATTCTAAAATAATAAGTGGAACCAGCTAAATTACACTAGATTTA
CTCGATTAAATTATAAAAACAAATAACACTATTTTAATCTTAGACGAAACTGACTAATTA
ATGAGGTTACTTTAATATGGAGTACATTATGATGAGTTAAAGCAAAATAGTAACGAATAA
AGATTAGATAAAATTGTTAAATGGGTGAAGAAGAAAAAGAAAGAAAATTGCATCATTCCA
AGAATAATAATGACATAATTAATAAAAGAGAAAAAATAAATGAGCTATAAAGACTTAGAT
AGTAAATTCAAAGAAATAGTAGATAACTCTCCTTAAAATTCAGTATTTGCTTTCAATTTT
GAAATAGAAGATGATAAATCTTTAAACAACAGTTTAAATGTATCTAACCCATTTTGCATA
TTTGTGTCCATTTGA


>TTHERM_00421200(protein)
MEKPSQQGTYVSIFQQLQSQKSQTTGSSSIFSGLMKTQSSDIIQTSSQKSSKKNKKPNLQ
DLEQSSTTLKKIQTSQDQAPKDECEISQESINNKQTSKQEIKNKIEIVDHAKPRKQTSTR
VFQSLLQWLFTKQGINPLWIMIEDRHLIQNFVYITLTVPPDFEKRLLAKQDFPFLGQYYD
QKNIAVFKERTVQNEDNYWHSLFQTKLTEDISLPLFNKNTVSPQQQINQEQYQAMTYEEK
LYYKYSQFCHSKQTLKNNLYPTESEDFPNYVSSTESTLKFDTVKFENKILGLDCEMVSTE
YGLELARISLVNFDGEVLIDQLVKTPNRIINYNTQYSGITQEMLKDVKVDLQQAQKLLFQ
YVCQDTILIGHSLENDLVAMQVIHNKVIDTSILFLTKNERKLKLKDLAQKFLNCKIQQGS
HCPSEDAKSALSLAKLRIEILEKFDNSKIISGTSQITLDLLDQIIKTNNTILILDETDQL
MRLLQYGVHYDELKQNSNEQRLDKIVKWVKKKKKENCIIPRIIMTQLIKEKKQMSYKDLD
SKFKEIVDNSPQNSVFAFNFEIEDDKSLNNSLNVSNPFCIFVSI


>TTHERM_00421200(gene)
ATGGAAAAACCAAGCTAATAAGGAACATATGTTTCAATATTCTAGTAACTACAAAGCTAA
AAAAGCTAGACAACAGGAAGCTCATCAATATTTAGTGGCTTAATGAAAACATAGTCTAGT
GATATTATATAAACATCTTCATAAAAGTCTAGCAAAAAAAATAAAAAACCTAACTTATAA
GATTTAGGTAGAAATAAGTTAAAAATATAACGAAATTAATATATCTTTTTAAAATATATA
AGAATAAAGCTCAACTACTCTGAAAAAGATACAAACTAGTTAAGATCAGGCACCAAAAGA
TGAATGTGAAATATCTTAGGAATCAATCAATAATAAATAAACAAGCAAATAGGAGATAAA
AAATAAAATTGAAATAGTTGATCATGCTAAACCCCGCAAATAAACATCAACAAGAGTATT
TTAAAGTTTACTGTAATGGTTATTTACTAAATAAGGAATAAATCCACTTTGGATTATGAT
AGAAGTAAATCATATTCGAGAGTTAATTTTTATTTACTTATTAATTCTTAATATCTAAAG
GATAGACACCTAATTTAGAATTTTGTATATATTACATTAACTGTACCTCCTGATTTTGAA
AAGCGCTTGTTAGCTAAATAGGATTTTCCTTTTTTAGGTTAATATTATGATTAGAAAAAT
ATTGCAGTTTTTAAAGAAAGAACAGTTCAAAATGAAGATAATTATTGGCATTCCCTATTC
TAAACAAAGTTAACAGAAGATATTTCTCTTCCACTCTTTAACAAAAATACAGTCTCTCCC
TAATAATAAATAAACTAAGAGTAGTATTAAGCAATGACTTATGAAGAAAAACTATATTAT
AAATATTCATAATTTTGTCATTCTAAATAGACTCTTAAGAATAATTTGTATCCTACTGAG
AGTGAAGACTTTCCTAATTATGTTAGCTCAACTGAGAGTACATTAAAATTTGACACAGTT
AAATTTGAAAACAAAATTCTTGGATTAGATTGTGAAATGGTATTCGAAAATTATTATTAA
TAATAAATAAATAAATATTAAAGTGGGTTAATTAAATATTAGGTTTCAACTGAGTATGGT
TTAGAGCTTGCAAGAATAAGTTTAGTTAATTTCGATGGTGAAGTTTTGATAGACTAACTG
GTAAAAACGCCAAATAGGATTATAAATTATAACACTTAATATAGTGGAATAACATAAGAA
ATGTTAAAAGATGTAAAAGTAGATTTACAGTAAGCACAGAAACTACTATTTTAGTATGTT
TGCTAAGACACCATTCTCATAGGACATTCTTTAGAGAATGATTTAGTAGCTATGCAAGTA
TTTATTTAGTTATTTTTTAGGTCATAATTATATATAAATAATCTCATGAAAAAATTAAAG
GTAATTCATAACAAGGTTATAGACACAAGTATATTATTTTTGACAAAGAATGAAAGAAAG
CTAAAATTAAAGGATTTGGCCTAAAAATTTTTGAATTGCAAAATTTAGTAAGGTTCTCAC
TGTCCTTCAGAAGATGCAAAAAGTGCATTAAGCTTAGCAAAATTGAGAATTGAAATATTA
GAAAAGTTTGATAATTCTAAAATAATAAGTGGAACCAGCTAAATTACACTAGATTTACTC
GATTAAATTATAAAAACAAATAACACTATTTTAATCTTAGACGAAACTGACTAATTAATG
AGGTTACTTTAATATGGAGTACATTATGATGAGTTAAAGCAAAATAGTAACGAATAAAGT
ATTTTACACTAATTAATTAATGATATAAGCTAAATAAAATTTTATTTTAAATTAGGATTA
GATAAAATTGTTAAATGGGTGAAGAAGAAAAAGAAAGAAAATTGCATCATTCCAAGAATA
ATAATGACATAATTAATAAAAGAGAAAAAATAAATGAGCTATAAAGACTTAGATAGTAAA
TTCAAAGAAATAGTAGATAACTCTCCTTAAAATTCAGGTATATAAATCCATATCTGATTC
ATTCATTAAATCTTAATTTTATTCTAAAAAATAGTATTTGCTTTCAATTTTGAAATAGAA
GATGATAAATCTTTAAACAACAGTTTAAATGTATCTAACCCATTTTGCATATTTGTGTCC
ATTTGA