Identifiers and Description

Gene Model Identifier

TTHERM_00437650

Standard Name

REV3 (homolog to human REV3 a translesion DNA polymerase)

Aliases

PreTt05421 | 49.m00193 | 3708.m00043

Description

REV3 DNA polymerase type-B family protein; DNA polymerase family B containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF00136 ) DNA polymerase family B
  • ( PF02394 ) Interleukin-1 propeptide
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF03104 ) DNA polymerase family B, exonuclease

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00437650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12457.19.997093137033517e-262DNA polymerase family B contai
ning protein (1209 aa)
OxytrichaContig18916.0.g483.999622461503957e-161DNA polymerase family B
SGDYPL167C5.0011520612761715e-143REV3 Catalytic subunit of DNA
polymerase zeta, involved in t
ranslesion synthesis during po
st-replication repair; require
d for mutagenesis induced by D
NA damage; involved in double-
strand break repair
DictyBaseDDB_G02716084.001158060863534e-95rev3 on chromosome: 2 position
480277 to 488472
WormBaseWBGene000213444.000477177765533e-93DNA polymerase status:Partia
lly_confirmed UniProt:Q9BKQ3
protein_id:CCD61513.1
Stentor CoeruleusSteCoe_304281.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437650(coding)
ATGAAAGTGACAAATGTTGCTTCTCCTTTAAATGAAAACTTCTTAGATGAGCATTTAAAA
AAGAAGGGATAGCTGTAAACTTTAAACATTATAGCATTTAGTCACGATTTCATTATGATT
AAGCTACCTTAAGATAATGGTCACATCAGTTACTTTATGCATTTTTATAGTGATAACTAC
ATTTATGGAATGAAAGAAGTGTATGCAATAAACTATAAATTTAGAAAAGATTTTAGTGAA
AACAATGCTAATATTTTTCAAAAGCTTTCTCTTAATTAAATTGCTAAAGGATAAATGAAA
TAAAATCTTTACAATTATGAATTTGATCTCTTGGAAATATACGAAGAGTTTCCTGAATAC
TTTTCTAGGTAATAGAAATCTTCGACTTGTTATATAGAAGCAGATGTTGAAAGTAAAAAT
CTGATTAATTTTATTTATCACTGTGATAAAGATAAAGAAGATGATGAAAGCAGTGATGAT
GAAGCTAATTAAAGTTAAAAAAATAACTTTTAAATGCTTTCTTTAGATAAAAATCCTTTT
CTTAAATACACTCATTTTGAAAGAGGGAAGGTTCTTAGTTTTGAAATAACTGTGCAAATC
ACAAAAGCCATTAAAGAATTGTGGTTGGAAGAAAATAGAAGAAGATAAATTTTTTAAATA
AACTCCCCTAACACAATACGAATTTCTCTAGAAAATAACATTGAGGGATCATTAGAATTT
AGGACAGGTAGATGTGATATATACAATTCTGTAAATCACATGAATGATGAAAAAGTTAGG
AAATAGTTTAACCAACACATTTTACAGTATTTCTAAAAGTCGCAAACTAAATTGAAAGAC
CCTGATGAAATTTTCTTAAACTTGAATGTGATTTAGAATTTTTTCAAGCAAAAATAGAAT
TAAAAAAATGAAATTTATTCTAAAGTAGTTAGTAGATTTGAAGATTACAAAACTAGGAAA
AAAGGTATTTTGGAAATGCTCCTTTAGCAAAATGATGAAGAAGCCGAAGATAAATATCTT
AAAAAGTAGCTTGATAAGCAATCAATAGACTTTGAGGTGTATATGGGTGATGGAGATGAA
GATCCTGAAGTGTGCTTATCAGATAAAGAAGAGGAAGAAGAAAAAGAAATGATAGACCTA
GAAGATATCTTAAAAGATAATTAGCTATTAAAATCTAGTACAGAGAATAAAAATGCTTTT
GATGTGATATAATCAAATGCAATGAAAAAACCAAATCATGTTGCTTTCTGGAGAAATCGC
TACAAAGTCGATAAAAATAATTTGAAGTAGAACGTTGATTCTATTTTTGATGTATGTAAA
TACTGTAACTAACCTGTTCATATTTGTCGATGCTAGGTTGAAATTAATAAATCACTTAAA
GATAAACCATTTTTATTTCCTGAGGAAACTTTTTTTGAATAGCCTATAAACAGCAATTAG
CTTTATTTTGAAACCTTTTAATTTACATATTCGAAGAAACCACCTCCTTTTGAAGCTATT
GTCAAAAATTTTTAATAATCAAACTCATTCTTTGAGCATCAATACCCTTATTACGAAAAT
ATGGTTGATTTATTTGATCACTATCAAATGAAAAATAAAAATGTAGTCAACAAGCTATAA
TAAGCTCAAATCTTAAGTCATGGATTGATAAAAGCTCCTATAAATAAACTATATGCATGT
GATATTAAAAATGAATTAAAATTACCTAAATTTTTCAGGATATATTTAACTGATGACTAT
GAATCGTTTAAAATATCAATGTATGATAATAAATAAACGTTCAAATATCAATAGCAACCA
CCTTCATATTAATAAATCTTAAAAGATTTTTAGAATTAAACTCCTCAATAACCTAGTCGA
CTTACTGATGAGTTTAACATTATTTCACCATTCAAAGATAAATCTCCAATAAAAACTAGA
AATTCTTTAAATCAAAAATCACCAATTTAAAACAAATTTGTCGGAGATATAACACTAATG
CTCGTAGAAATATTTGCAAGAAGTTCACCTCACAAACTGCCTAATCCTGCCACTGATTCA
GTTGATGCCTTATTTTTTAGTATTTACAATGGAAAATTCGATGTTTCTCCTCGATACTTT
AACAGTGAAGAATAAAAAGCAATTCAAGGAATGATAATAGTAGATCCTATAAATTTTAGC
TATTTGTAAGAGAATGAAGTTAACTTCAAAGCATTTTATTAAACAAACGAAAATATCAGT
GAAATTATAGTTGTAGAAAACGAAGAAGACTTAATTTAGGTATTTATAATTATTACCTAA
AAAATAGATCCAGATATATTTGGTGGATGGGATATGGAAAAGAGTTCTTTAAATTATTTA
GGCTAAAGATGCTAAATACTTGGTATTTAACTATTCGAATTATTAAGTAGATGCCCTTCA
AATATCAATAAATTAATTTAAGTATTACAATTTAATTCTTTTCAAACTTAGAATGATGAA
TTTTCTGTTTTTTCAAATGATACTCTAAACTTTAATTCTTCATTGTCTAGCTTCAGTCAA
CTTAATTAAAGTTTTTAGAGTGATTCTTTACCTGATTAATCTCCTATACCAAATGAAGGT
TAGTAAGTAGACAGTAAATAAAAAGGAAGATTAAGAATAAACAGCTTAGATTTATATTAA
AGTACTAGCATAAGCTCATCTATTTCTATAAAACCTTCTAAAATGAAAAGAACACTTTCT
GCTGATAGTTAAGTTTTAGTTTCTATCCCTGAATTAAATCAAGAGCATTAAGTTAAATTT
TTTGCTGCTGAAAATGAAGAAACTGAAGAAGATCCTTAAAAAGAAATTTTAACAAGCTAA
AATTCAAATTCCTTAAGCTCTTCAATTTCAAAACACATTTAATCAAAGTAAAAAAATAAA
GTTTTTGAAATGGATTTATCTTCACCTTCATTCCATTCTTCAAATAAATCTTAAAATTAG
CATTTTTCATAAAAATCATAATTTTCATAGTAGGGAATGCTCTACTAAGGTACTCAATAT
AGCTTTATCCAAACATCACACTCTAAAAAGAAGGAATTTGATTTAAATTCACAGAAAAAG
TTTGATGTAAATTTAAAAGAAGATTCTAAAATGAGCAAAAAAACTTAATCTAATCAGAGT
TCAATAAAACAACAAAATGATCCTTAATCTGCTTAATAAAAAGAAAATATCAAAGAATTA
CGAAGAGGTTAACTTTACCATAATTTAAATTTAAAAATAAGAGGAAGAATCATTTGGAAT
ATTTGGAGATTATGTAGAGATAAATTAAAATTAACTAATTTTGATGCAGAAAATGTGTAT
TACGAATTATTTTAAATAAGAAATCCAGTTTATAGCAACTGGACACTTACTAAATGGTTT
AATAGTGAATCAGCTAAACATAAGACCCTAGTATTTGACTACTACTTTAATAAATTAAAA
ATTAATCAAATAGTCCTAGATAAACTTGATATAATATAAAGAACTACATCTTCTGCTCGC
CTTTATGGATGCGATTTCGAGAGCATTATAACAAGAGGATCTTAATTTAGGGTAGAAGGT
GTTTTAGTTAGAGTAACTAAATAATACGGATATTTGATGCTTTCTGCAAGTAGAATGCAA
GTTGCTTCTTAAAAAATACTTGAGTGTATGCCTTTGGTCATGGAGCCTCCGAAAATGCTT
TTTGTTGATCCTGTTATTGTTATGGATTTTCAATCTCTTTACCCTTCAGTAATGATTGCT
TATAATTATTGTTATTCTACCTGTTTGGGAAATATTAATGAACAGTTTAATAATGGAGGA
AGCGGAAGACTCGGTGTTAACTAAGATGCACACTTAAAATTTGAATAATTATTTGGAAAA
GATAGAAAATTTAATCCTAAAGATATGGATCAATACCATCAAGACATATTTATAGCCCCA
AATAAAGTAGCTTATGTTAGAAAAACTATAAGGGAAGGAATTCTACCATAAATATTGCAC
GAATTCCTACTCACAAGAATTATGATTAAAAAATCAGCTGGATTTTATAAGGACGATAAA
TATTTAAGCAAATTACTTGATGCTTAATAGTAGTCTATAAAACTTTTTATGTGCGTTGTT
TATGGATATACTGGAGCATCTTTTTCAGGTAGAATGCCTTCTGTAGATATAGCAGATTCT
ATTGTTGAGACAGGAAGATATCTTTTAAACCAAGTGTGCGAATACATTAATAGCAATAAA
GACTGGTATGCAAAAGTTGTATATGGTGATACAGACTCAGTATTTGTTTTACTTAAAGGT
AGAAGTGTGGAAGAAGCCTTTAGGATAGGTAAAGAGATAGCAGAATCGATTACAAAGTAA
TATCCTTATCCGATAGAACTAAAATTTGAAAAAGTATTTAGAGAATTAATTTTAGTTTCA
AAAAAGAGATATGTTGGATATAAAATGGAAAAAATTACTGATAAGCCTGAATTTTTGGCA
AAAGGCATTGAAATAGTAAGAAGAGATGGTTGTGATGCAGTTGTTAAATTAATGAAAAAA
AGTTTAAACATTCTTTTTGAAACAAAAAATTTATCCAAATTAAAAAATTACTTGAATAAA
CAATGGGCAAAGATACTTCATGGTCATGTTAATTTTAAAGATTTTTGTATTGCAAAAGAA
GTTAAGTTAGGAAAATACAAAGAAGATAGAGTACCTGCACATGGTATAGTAGGATTAAAA
ATAACGGAATAAGATTAATTAGCAAAACCTAAGTATGGAGAAAGAGTTAAATATCTGGTA
GTACAAGGTGAGCAAAAAAGTAAAGTAAAAGACTTGGTTGTATCAGTTCCAGAGTTTTTC
AATAAATTTAATCATCAAATGAATAGCTTGTATTACATAAACAGATAAATTAATTCATCC
ATAGGAAGATTGTTTTCAACTTTTGATGTGGATATAAAGGATTGGTTTTTCAATATGCCA
AAAGGCAAGATTAAAGTGAATTTCCTAAAAAATCATTAATTTATTCAACAAAGATAAAGC
AAGACCTAAGATTTAAGAAGTCAGTTGCATATAGAAAACTACTATCGATTAGAAGTATGC
ATAATTTGTTATGAAAGATGCTCTGAAGATATTTGTAATTCATGTCTTTCTGATATACCT
ACTCTTTCATACTTACTTAGTCATAAATAGCAAATAATACATTCATAGTATTAAGAAATT
GAAAGAAAGTGCAAAAACTGTAGTTCATTAGAAAATAAAGAAATTGAAGAAGTTCCTTGT
GTTGAGTATAATTGTCCATATTTATATGCAAAAAAATATTCTAAAGATAATCTTGACTAC
CTCAGCAAGATTATTTCTAAATATTTAAACATAATCAACGAATCATTTTGA


>TTHERM_00437650(protein)
MKVTNVASPLNENFLDEHLKKKGQLQTLNIIAFSHDFIMIKLPQDNGHISYFMHFYSDNY
IYGMKEVYAINYKFRKDFSENNANIFQKLSLNQIAKGQMKQNLYNYEFDLLEIYEEFPEY
FSRQQKSSTCYIEADVESKNLINFIYHCDKDKEDDESSDDEANQSQKNNFQMLSLDKNPF
LKYTHFERGKVLSFEITVQITKAIKELWLEENRRRQIFQINSPNTIRISLENNIEGSLEF
RTGRCDIYNSVNHMNDEKVRKQFNQHILQYFQKSQTKLKDPDEIFLNLNVIQNFFKQKQN
QKNEIYSKVVSRFEDYKTRKKGILEMLLQQNDEEAEDKYLKKQLDKQSIDFEVYMGDGDE
DPEVCLSDKEEEEEKEMIDLEDILKDNQLLKSSTENKNAFDVIQSNAMKKPNHVAFWRNR
YKVDKNNLKQNVDSIFDVCKYCNQPVHICRCQVEINKSLKDKPFLFPEETFFEQPINSNQ
LYFETFQFTYSKKPPPFEAIVKNFQQSNSFFEHQYPYYENMVDLFDHYQMKNKNVVNKLQ
QAQILSHGLIKAPINKLYACDIKNELKLPKFFRIYLTDDYESFKISMYDNKQTFKYQQQP
PSYQQILKDFQNQTPQQPSRLTDEFNIISPFKDKSPIKTRNSLNQKSPIQNKFVGDITLM
LVEIFARSSPHKLPNPATDSVDALFFSIYNGKFDVSPRYFNSEEQKAIQGMIIVDPINFS
YLQENEVNFKAFYQTNENISEIIVVENEEDLIQVFIIITQKIDPDIFGGWDMEKSSLNYL
GQRCQILGIQLFELLSRCPSNINKLIQVLQFNSFQTQNDEFSVFSNDTLNFNSSLSSFSQ
LNQSFQSDSLPDQSPIPNEGQQVDSKQKGRLRINSLDLYQSTSISSSISIKPSKMKRTLS
ADSQVLVSIPELNQEHQVKFFAAENEETEEDPQKEILTSQNSNSLSSSISKHIQSKQKNK
VFEMDLSSPSFHSSNKSQNQHFSQKSQFSQQGMLYQGTQYSFIQTSHSKKKEFDLNSQKK
FDVNLKEDSKMSKKTQSNQSSIKQQNDPQSAQQKENIKELRRGQLYHNLNLKIRGRIIWN
IWRLCRDKLKLTNFDAENVYYELFQIRNPVYSNWTLTKWFNSESAKHKTLVFDYYFNKLK
INQIVLDKLDIIQRTTSSARLYGCDFESIITRGSQFRVEGVLVRVTKQYGYLMLSASRMQ
VASQKILECMPLVMEPPKMLFVDPVIVMDFQSLYPSVMIAYNYCYSTCLGNINEQFNNGG
SGRLGVNQDAHLKFEQLFGKDRKFNPKDMDQYHQDIFIAPNKVAYVRKTIREGILPQILH
EFLLTRIMIKKSAGFYKDDKYLSKLLDAQQQSIKLFMCVVYGYTGASFSGRMPSVDIADS
IVETGRYLLNQVCEYINSNKDWYAKVVYGDTDSVFVLLKGRSVEEAFRIGKEIAESITKQ
YPYPIELKFEKVFRELILVSKKRYVGYKMEKITDKPEFLAKGIEIVRRDGCDAVVKLMKK
SLNILFETKNLSKLKNYLNKQWAKILHGHVNFKDFCIAKEVKLGKYKEDRVPAHGIVGLK
ITEQDQLAKPKYGERVKYLVVQGEQKSKVKDLVVSVPEFFNKFNHQMNSLYYINRQINSS
IGRLFSTFDVDIKDWFFNMPKGKIKVNFLKNHQFIQQRQSKTQDLRSQLHIENYYRLEVC
IICYERCSEDICNSCLSDIPTLSYLLSHKQQIIHSQYQEIERKCKNCSSLENKEIEEVPC
VEYNCPYLYAKKYSKDNLDYLSKIISKYLNIINESF


>TTHERM_00437650(gene)
ATGAAAGTGACAAATGTTGCTTCTCCTTTAAATGAAAACTTCTTAGATGAGCATTTAAAA
AAGAAGGGATAGCTGTAAACTTTAAACATTATAGCATTTAGTCACGATTTCATTATGATT
AAGCTACCTTAAGATAATGTAAGACTTTCATTTGGTAAAGAGTATTTCTATGAAGATTTT
GAATTCTATAAGAACATAACAAACTATAAAGGATAAAAAGTTTAACAAGTTCCCATTATA
AGATTGTTTGGGGCAAATAAATATGGATAAAAGTGCTGTTTAAATGTTCATAATGTAAAT
TTTATTGCAAATCAAACACTAAAACATTAATTTATTTGGTAATTTTCAATAGTATTTTCC
TTACTTCTATGTGAAAGCTGATAGAATTTCACATATTTTTGAATCTAAAGGTTCCACTTG
ATGTATAATTTTTGATAATGCTAAAATCTATTTTATTTTTATATTACATAGATAGAGAAA
AGTTAGATTCTTTTTTATATGAATTTTGCTCTAAAGTAGAAGAATGCTTCTAAAAGGTCT
ATTCTTAATCAAATGCTAAAAACTAACCAAATAAAGCCTAAAAGTATGCAGGATTTAAAA
ACTTATAATAAATAGTACACAAAGCTGAAATAGTATACAAAAAAGATTATTATGGATATC
ATGCTTACGATGAACCTTTTATCAAGATAATTTATTACAATCCAAGTCATGGGAAAAAGA
TACAAGAAATACTCATAGCAGGAGCAATTATGAATCTAAGATTCTAAATTTATGATGTAA
TAATAAATTAATTACTGAAAATTTTACTCATTAATCTATCTCATATAAATAATATTTAAT
TTTATTAATCTTAAAGGGTCACATCAGTTACTTTATGCATTTTTATAGTGATAACTACAT
TTATGGAATGAAAGAAGTGTATGCAATAAACTATAAATTTAGAAAAGATTTTAGTGAAAA
CAATGCTAATATTTTTCAAAAGCTTTCTCTTAATTAAATTGCTAAAGGATAAATGAAATA
AAATCTTTACAATTATGAATTTGATCTCTTGGAAATATACGAAGAGTTTCCTGAATACTT
TTCTAGGTAATAGAAATCTTCGACTTGTTATATAGAAGCAGATGTTGAAAGTAAAAATCT
GATTAATTTTATTTATCACTGTGATAAAGATAAAGAAGATGATGAAAGCAGTGATGATGA
AGCTAATTAAAGTTAAAAAAATAACTTTTAAATGCTTTCTTTAGATAAAAATCCTTTTCT
TAAATACACTCATTTTGAAAGAGGGAAGGTTCTTAGTTTTGAAATAACTGTGCAAATCAC
AAAAGCCATTAAAGAATTGTGGTTGGAAGAAAATAGAAGAAGATAAATTTTTTAAATAAA
CTCCCCTAACACAATACGAATTTCTCTAGAAAATAACATTGAGGGATCATTAGAATTTAG
GACAGGTAGATGTGATATATACAATTCTGTAAATCACATGAATGATGAAAAAGTTAGGAA
ATAGTTTAACCAACACATTTTACAGTATTTCTAAAAGTCGCAAACTAAATTGAAAGACCC
TGATGAAATTTTCTTAAACTTGAATGTGATTTAGAATTTTTTCAAGCAAAAATAGAATTA
AAAAAATGAAATTTATTCTAAAGTAGTTAGTAATATTAATGTTTATAATTCTATTTAATA
TTAAAAAGGCTGTTTTATATATATTAAAAGGTAGATTTGAAGATTACAAAACTAGGAAAA
AAGGTATTTTGGAAATGCTCCTTTAGCAAAATGATGAAGAAGCCGAAGATAAATATCTTA
AAAAGTAGCTTGATAAGCAATCAATAGACTTTGAGGTGTATATGGGTGATGGAGATGAAG
ATCCTGAAGTGTGCTTATCAGATAAAGAAGAGGAAGAAGAAAAAGAAATGATAGACCTAG
AAGATATCTTAAAAGATAATTAGCTATTAAAATCTAGTACAGAGAATAAAAATGCTTTTG
ATGTGATATAATCAAATGCAATGAAAAAACCAAATCATGTTGCTTTCTGGAGAAATCGCT
ACAAAGTCGATAAAAATAATTTGAAGTAGAACGTTGATTCTATTTTTGATGTATGTAAAT
ACTGTAACTAACCTGTTCATATTTGTCGATGCTAGGTTGAAATTAATAAATCACTTAAAG
ATAAACCATTTTTATTTCCTGAGGAAACTTTTTTTGAATAGCCTATAAACAGCAATTAGC
TTTATTTTGAAACCTTTTAATTTACATATTCGAAGAAACCACCTCCTTTTGAAGCTATTG
TCAAAAATTTTTAATAATCAAACTCATTCTTTGAGCATCAATAGTAAAATAATTATACCT
ATTTTTTTTTTCATTTATTTATTTAAATAGTTTAATTAAATTTCAAAAGCCCTTATTACG
AAAATATGGTTGATTTATTTGATCACTATCAAATGAAAAATAAAAATGTAGTCAACAAGC
TATAATAAGCTCAAATCTTAAGTCATGGATTGATAAAAGCTCCTATAAATAAACTATATG
CATGTGATATTAAAAATGAATTAAAATTACCTAAATTTTTCAGGATATATTTAACTGATG
ACTATGAATCGTTTAAAATATCAATGTATGATAATAAATAAACGTTCAAATATCAATAGC
AACCACCTTCATATTAATAAATCTTAAAAGATTTTTAGAATTAAACTCCTCAATAACCTA
GTCGACTTACTGATGAGTTTAACATTATTTCACCATTCAAAGATAAATCTCCAATAAAAA
CTAGAAATTCTTTAAATCAAAAATCACCAATGTAAATTTATAAAAAAGTATTCAAAGAAA
ATTTAAATTTCTTTTGATTTAAATAATTTTAAATAAGTTAAAACAAATTTGTCGGAGATA
TAACACTAATGCTCGTAGAAATATTTGCAAGAAGTTCACCTCACAAACTGCCTAATCCTG
CCACTGATTCAGTTGATGCCTTATTTTTTAGTATTTACAATGGAAAATTCGATGTTTCTC
CTCGATACTTTAACAGTGAAGAATAAAAAGCAAGTAAATCATTAATAATGTTTATGTTTA
AAAAAGAAAATTATTTTTAATTAAGTTAGAATTTATCTTTTTTAACTATTTTTTATTTGT
AAAACATATTAGTTCAAGGAATGATAATAGTAGATCCTATAAATTTTAGCTATTTGTAAG
AGAATGAAGTTAACTTCAAAGCATTTTATTGTAAAATACAAATACTATTAGAACAGAAAT
ATTAACTATTTTTATTAAATATATAGAAACAAACGAAAATATCAGTGAAATTATAGTTGT
AGAAAACGAAGAAGACTTAATTTAGGTATTTATAATTATTACCTAAAAAATAGATCCAGA
TATATTTGGTGGATGGGATATGGAAAAGAGTTCTTTAAATTATTTAGGCTAAAGATGCTA
AATACTTGGTATTTAACTATTCGAATTATTAAGTAGATGCCCTTCAAATATCAATAAATT
AATTTAAGTATTACAATTTAATTCTTTTCAAACTTAGAATGATGAATTTTCTGTTTTTTC
AAATGATACTCTAAACTTTAATTCTTCATTGTCTAGCTTCAGTCAACTTAATTAAAGTTT
TTAGAGTGATTCTTTACCTGATTAATCTCCTATACCAAATGAAGGTTAGTAAGTAGACAG
TAAATAAAAAGGAAGATTAAGAATAAACAGCTTAGATTTATATTAAAGTACTAGCATAAG
CTCATCTATTTCTATAAAACCTTCTAAAATGAAAAGAACACTTTCTGCTGATAGTTAAGT
TTTAGTTTCTATCCCTGAATTAAATCAAGAGCATTAAGTTAAATTTTTTGCTGCTGAAAA
TGAAGAAACTGAAGAAGATCCTTAAAAAGAAATTTTAACAAGCTAAAATTCAAATTCCTT
AAGCTCTTCAATTTCAAAACACATTTAATCAAAGTAAAAAAATAAAGTTTTTGAAATGGA
TTTATCTTCACCTTCATTCCATTCTTCAAATAAATCTTAAAATTAGCATTTTTCATAAAA
ATCATAATTTTCATAGTAGGGAATGCTCTACTAAGGTACTCAATATAGCTTTATCCAAAC
ATCACACTCTAAAAAGAAGGAATTTGATTTAAATGTATTTTTTTATTTAAATTTAAAAAA
TAAATAAAATATTTAATTATAATAAAAAAAGTCACAGAAAAAGTTTGATGTAAATTTAAA
AGAAGATTCTAAAATGAGCAAAAAAACTTAATCTAATCAGAGTTCAATAAAACAACAAAA
TGATCCTTAATCTGCTTAATAAAAAGAAAATATCAAAGAATTACGAAGAGGTTAACTTTA
CCATAATTTAAATTTAAAAATAAGAGGTAAATAATTGTTTTGATAAAATTTAAATAATTC
TCATAATTATTTAGGAAGAATCATTTGGAATATTTGGAGATTATGTAGAGATAAATTAAA
ATTAACTAATTTTGATGCAGAAAATGTGTATTACGAATTATTTTAAATAAGAAATCCAGT
TTATAGCAACTGGACACTTACTAAATGGTTTAATAGTGAATCAGCTAAACATAAGACCCT
AGTATTTGACTACTACTTTAATAAATTAAAAATTAATCAAATAGTCCTAGATAAACTTGA
TATAATATAAAGAACTACATCTTCTGCTCGCCTTTATGGATGCGATTTCGAGAGCATTGT
AAATTAAATAAATAAAAATAAATTTAAACTCAATTAATGTATATTTTAAGATAACAAGAG
GATCTTAATTTAGGGTAGAAGGTGTTTTAGTTAGAGTAACTAAATAATACGGATATTTGA
TGCTTTCTGCAAGTAGAATGCAAGTTGCTTCTTAAAAAATACTTGAGTGTATGCCTTTGG
TCATGGAGCCTCCGAAAATGCTTTTTGTTGAGTAAAAACTTTATTTTTTTTTAGTTTTAA
ATTGCTTAGCTTAATAATTTTTAATTATGTAGTCCTGTTATTGTTATGGATTTTCAATCT
CTTTACCCTTCAGTAATGATTGCTTATAATTATTGTTATTCTACCTGTTTGGGAAATATT
AATGAACAGTTTAATAATGGAGGAAGCGGAAGACTCGGTGTTAACTAAGATGCACACTTA
AAATTTGAATAATTATTTGGAAAAGATAGAAAATTTAATCCTAAAGATATGGATCAATAC
CATCAAGACATATTTATAGCCCCAAATAAAGTAGCTTATGTTAGAAAAACTATAAGGGAA
GGAATTCTACCATAAATATTGCACGAATTCCTACTCACAAGAATTATGATTAAAAAATCA
GCTGGATTTTATAAGGACGATAAATATTTAAGCAAATTACTTGATGCTTAATAGTAGTCT
ATAAAACTTTTTATGTGCGTTGTTTATGGATATACTGGAGCATCTTTTTCAGGTAGAATG
CCTTCTGTAGATATAGCAGATTCTATTGTTGAGACAGGTATATTTTTAATTTATCAAAAA
TCACTTTAAATTTTGCTTCAAATTAAAATAGGAAGATATCTTTTAAACCAAGTGTGCGAA
TACATTAATAGCAATAAAGACTGGTATGCAAAAGTTGTATATGGTGATACAGACTCAGTA
TTTGTTTTACTTAAAGGTAGAAGTGTGGAAGAAGCCTTTAGGATAGGTAAAGAGATAGCA
GAATCGATTACAAAGTAATATCCTTATCCGATAGAACTAAAATTTGAAAAAGTATTTAGA
GAATTAATTTTAGTTTCAAAAAAGAGATATGTTGGATATAAAATGGAAAAAATTACTGAT
AAGCCTGAATTTTTGGCAAAAGGCATTGAAATAGTAAGAAGAGATGGTTGTGATGCAGTT
GTTAAATTAATGAAAAAAAGTTTAAACATTCTTTTTGAAACAAAAAATTTATCCAAATTA
AAAAATTACTTGAATAAACAATGGGCAAAGATACTTCATGGTCATGTTAATTTTAAAGAT
TTTTGTATTGCAAAAGAAGTTAAGTTAGGAAAATACAAAGAAGATAGAGTACCTGCACAT
GGTATAGTAGGATTAAAAATAACGGAATAAGATTAATTAGCAAAACCTAAGTATGGAGAA
AGAGTTAAATATCTGGTAGTACAAGGTGAGCAAAAAAGTAAAGTAAAAGACTTGGTTGTA
TCAGTTCCAGAGTTTTTCAATAAATTTAATCATCAAATGAATAGCTTGTATTACATAAAC
AGATAAATTAATTCATCCATAGGAAGATTGTTTTCAACTTTTGATGTGGATATAAAGGTA
TTTCTTTTTTCAAAAAAAGTAGCTTGATATAATTAATTTTAAAAAAAGGATTGGTTTTTC
AATATGCCAAAAGGCAAGATTAAAGTGAATTTCCTAAAAAATCATTAATTTATTCAACAA
GTAACATTAATAAAATTTTTTAAATAAATTATAATAAATATTTATTTATTTTTTAATTAG
AGATAAAGCAAGACCTAAGATTTAAGAAGTCAGTTGCATATAGAAAACTACTATCGATTA
GAAGTATGCATAATTTGTTATGAAAGATGCTCTGAAGATATTTGTAATTCATGTCTTTCT
GATATACCTACTCTTTCATACTTACTTAGTCATAAATAGCAAATAATACATTCATAGTAT
TAAGAAATTGAAAGAAAGTGCAAAAACTGTAGTTCATTAGAAAATAAAGAAATTGAAGAA
GTTCCTTGTGTTGAGTATAATTGTCCATATTTATATGCAAAAAAATATTCTAAAGATAAT
CTTGACTACCTCAGCAAGATTATTTCTAAATATTTAAACATAATCAACGAATCATTTTGA