Identifiers and Description

Gene Model Identifier

TTHERM_00245660

Standard Name

REC8 (RECombination 8)

Aliases

PreTt02461 | 21.m00292

Description

Alpha-kleisin subunit of the cohesin complex; required for meiotic double strand break repair

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00245660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00526.19.997093137033517e-262hypothetical protein (614 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_00245660(coding)
ATGATGGTTAGGCAATAAAATAACTAGAATACACAGAGTTAAAGCAATATCACAACCAGT
GTTAGTCAATATACATCAGAAGATTCCTAAAATTCTTAGGTTCAAAGAGAAAACAGGAAT
AAAATAATCTTAAAGTATGATGAAAACATTGCCAAAATAGTTGCTTTGGGCATGGAAGAA
AAGCTCATAAAAAATTAATTGGGAAAAATAGATATATCAGATGCACTTGTCAAAGTGAGT
AGTAATGTTAACATTTTTAGTGTTAAGTAGAGTGCTAATTTTTTGTTTGCAATATCTAAA
TTGATAAATTATGGATATCTCTCGCTAAATTAGGAATTAAAAGATTTCTTTGCAAGATTT
AAAGATTAGATTATGAAGTAGTAGTAGCAGTAATAGTAAAAAGAAAAGTAACATAGATCT
AGCAGAAAAAATTAGACTAAAAAAAGACTCAGAGACGCAGCAAAGGAGATAGCTGATAAC
TTAAGCAACAGCATTGATGAAAGATCTAACACTTCTATTTAGTAACCTAGACATATTTCT
ACAGAAGAGAGACTGAATATGCAAGAATAGAATCTGATATCACCTCTCGCTATGATGATT
AATTAAAGATCTGATTTAGATTCAGATAATGAAAATTCAAATACAGGTTTTAGCGATAAT
TTACCTGATCCTAATTAACAAAGACTTATGATGCTTGGAGAGGATAATTTAGCTGGGATA
GAATTTGATGGGGGACTTGGCATGGATACAGGTTTTGATTATGATGGATTTTAGTATGAT
TTTAGTGAACAAGATAGTTAAAGCTAAGGATTCAATAAGGTTAATGGAAATGCTATAAAT
ATCTCCCAAGAATTAAATTAAGTTGGCGACATCTCTGAAAGATATATAAGAAAAATTACC
AATTATGCCAATTAACAATCTTCAAAAAAGAAAAAAAAAACTAAACAAAAATAATAGGGA
CATAACAAAGAAGGCGAGCATGCAATTCTTAATGAAACAGTAGATATGGATAATTAAGAG
TTTTCAAAAGCTATGGATGAAAAATTAAATTAGTTCTATAGTAGCTAATCATAAAGAGTT
AATAAAAATATATCACATATTTCAGATATATCTAGATTATCGACCACATTATAATAGCCA
TCAATATTATCACAAAATTTTAATATCTATGAAGAATCAATCAGCGAAGCACCTTTCTAA
TAAATTAATATATCGAATTATTTAAATGCTTCCACCCTAGTTGACTAACCAATTTTGAAT
CTTACTAAGAAATTTGATGAAGCAATAAGCCTAAAAGAAAATGATAATAATGTGCTCCTT
TCTGAAGAACTTATTTCTAAATTAGAAAAAGCAATGCAAAATATAAATATTGATTTAGTA
AAATAAGACTAAGGTGGAGTGGATATGATGGATTTTAACTAGGATAACTAAGGCGGCTAC
ATGGATTATCCTGATGATTTTGGTAGCTTAGATTAATATAATCAATAAAAAGAAGAATAA
GATGGAGAACTAGAAATTCCTGTTCAAATACCAGAAATATAAAAATCTAAGCTAGAAAAA
GATAAAAAAATTGATGAAATTGATAGTTTATAAGACTTTGATATTACTCCTCTTGATAAA
AAAATTCTTACAGAAGAGGAATAAAGAGTTCTTCAGTAATATGACAAATTATTCACAAAA
TTAAGAGATATCCTAGACAAAGAACCAACTGCTGAGTTTAACGATGTTTATTAATCATTC
AAAAACTAAAAGAGTAAAGCAGAGCTCTTCTACGATATTTTGGAGTTATAAAAGCTTGGT
CAGATTTCTGTTTCTTAAAACGATAATATTCATTTTTCACCAATACAAATTCTTATCAAA
TGA


>TTHERM_00245660(protein)
MMVRQQNNQNTQSQSNITTSVSQYTSEDSQNSQVQRENRNKIILKYDENIAKIVALGMEE
KLIKNQLGKIDISDALVKVSSNVNIFSVKQSANFLFAISKLINYGYLSLNQELKDFFARF
KDQIMKQQQQQQQKEKQHRSSRKNQTKKRLRDAAKEIADNLSNSIDERSNTSIQQPRHIS
TEERLNMQEQNLISPLAMMINQRSDLDSDNENSNTGFSDNLPDPNQQRLMMLGEDNLAGI
EFDGGLGMDTGFDYDGFQYDFSEQDSQSQGFNKVNGNAINISQELNQVGDISERYIRKIT
NYANQQSSKKKKKTKQKQQGHNKEGEHAILNETVDMDNQEFSKAMDEKLNQFYSSQSQRV
NKNISHISDISRLSTTLQQPSILSQNFNIYEESISEAPFQQINISNYLNASTLVDQPILN
LTKKFDEAISLKENDNNVLLSEELISKLEKAMQNINIDLVKQDQGGVDMMDFNQDNQGGY
MDYPDDFGSLDQYNQQKEEQDGELEIPVQIPEIQKSKLEKDKKIDEIDSLQDFDITPLDK
KILTEEEQRVLQQYDKLFTKLRDILDKEPTAEFNDVYQSFKNQKSKAELFYDILELQKLG
QISVSQNDNIHFSPIQILIK


>TTHERM_00245660(gene)
AAAAACGAATTTGAAAATTGTGCAAAAATAATTTGTTTTTAAATCAATATTAAATAAATT
AATGCTAAATAATAATTAGAAACTAATACTCAACATAGATATTTCACAAAAGTAGATATA
ATAAAAAAGGTTAGCAACTTTATTTTAAAAATATTAAGTTTAAAAAATTAAAAGATTAAC
TGTTAATAGATCTAAATGATGGTTAGGCAATAAAATAACTAGAATACACAGAGTTAAAGC
AATATCACAACCAGTGTTAGTCAATATACATCAGAAGATTCCTAAAATTCTTAGGTTCAA
AGAGAAAACAGGAATAAAATAATCTTAAAGTATGATGAAAACATTGCCAAAATAGTTGCT
TTGGGCATGGAAGAAAAGCTCATAAAAAATTAATTGGGAAAAATAGATATATCAGATGCA
CTTGTCAAAGTGAGTAGTAATGTTAACATTTTTAGTGTTAAGTAGAGTGCTAATTTTTTG
TTTGCAATATCTAAATTGATAAATTATGGATATCTCTCGCTAAATTAGGAATTAAAAGAT
TTCTTTGCAAGATTTAAAGATTAGATTATGAAGTAGTAGTAGCAGTAATAGTAAAAAGAA
AAGTAACATAGATCTAGCAGAAAAAATTAGACTAAAAAAAGACTCAGAGACGCAGCAAAG
GAGATAGCTGATAACTTAAGCAACAGCATTGATGAAAGATCTAACACTTCTATTTAGTAA
CCTAGACATATTTCTACAGAAGAGAGACTGAATATGCAAGAATAGAATCTGATATCACCT
CTCGCTATGATGATTAATTAAAGATCTGATTTAGATTCAGATAATGAAAATTCAAATACA
GGTTTTAGCGATAATTTACCTGATCCTAATTAACAAAGACTTATGATGCTTGGAGAGGTA
AAAATAAAATATATTTTTTTTATTTAAACTCAAAAAAATCCTTTAAGAACATTCATTTAT
TATTAAATAAAATCCATGCTTAGTAAATTATTTTTATTAATTAAAAGGATAATTTAGCTG
GGATAGAATTTGATGGGGGACTTGGCATGGATACAGGTTTTGATTATGATGGATTTTAGT
ATGATTTTAGTGAACAAGATAGTTAAAGCTAAGGATTCAATAAGGTTAATGGAAATGCTA
TAAATATCTCCCAAGAATTAAATTAAGTTGGCGACATCTCTGAAAGATATATAAGAAAAA
TTACCAATTATGCCAATTAACAATCTTCAAAAAAGAAAAAAAAAACTAAACAAAAATAAT
AGGGACATAACAAAGAAGGCGAGCATGCAATTCTTAATGAAACAGTAGATATGGATAATT
AAGAGTTTTCAAAAGCTATGGATGAAAAATTAAATTAGTTCTATAGTAGCTAATCATAAA
GAGTTAATAAAAATATATCACATATTTCAGATATATCTAGATTATCGACCACATTATAAT
AGCCATCAATATTATCACAAAATTTTAATATCTATGAAGAATCAATCAGCGAAGCACCTT
TCTAATAAATTAATATATCGAATTATTTAAATGCTTCCACCCTAGTTGACTAACCAATTT
TGAATCTTACTAAGAAATTTGATGAAGCAATAAGCCTAAAAGAAAATGATAATAATGTGC
TCCTTTCTGAAGAACTTATTTCTAAATTAGAAAAAGCAATGCAAAATATAAATATTGATT
TAGTAAAATAAGACTAAGGTGGAGTGGATATGATGGATTTTAACTAGGATAACTAAGGCG
GCTACATGGATTATCCTGATGATTTTGGTAGCTTAGATTAATATAATCAATAAAAAGAAG
AATAAGATGGAGAACTAGAAATTCCTGTTCAAATACCAGAAATATAAAAATCTAAGCTAG
AAAAAGATAAAAAAATTGATGAAATTGATAGTTTATAAGACTTTGATATTACTCCTCTTG
ATAAAAAAATTCTTACAGAAGAGGAATAAAGAGTTCTTCAGTAATATGACAAATTATTCA
CAAAATTAAGAGATATCCTAGACAAAGAACCAACTGCTGAGTTTAACGATGTTTATTAAT
CATTCAAAAACTAAAAGAGTAAAGCAGAGCTCTTCTACGATATTTTGGAGTTATAAAAGC
TTGGTCAGATTTCTGTTTCTTAAAACGATAATATTCATTTTTCACCAATACAAATTCTTA
TCAAATGA