Identifiers and Description

Gene Model Identifier

TTHERM_00245660

Standard Name

REC8 (Recombination)

Aliases

PreTt02461 | 21.m00292

Description

alpha-kleisin subunit of the cohesin complex, required for meiotic double strand break repair

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00245660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00526.19.997093137033517e-262hypothetical protein (614 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_00245660(coding)
ATGATGGTTAGGCAATAAAATAACTAGAATACACAGAGTTAAAGCAATATCACAACCAGT
GTTAGTCAATATACATCAGAAGATTCCTAAAATTCTTAGGTTCAAAGAGAAAACAGGAAT
AAAATAATCTTAAAGTATGATGAAAACATTGCCAAAATAGTTGCTTTGGGCATGGAAGAA
AAGCTCATAAAAAATTAATTGGGAAAAATAGATATATCAGATGCACTTGTCAAAGTGAGT
AGTAATGTTAACATTTTTAGTGTTAAGTAGAGTGCTAATTTTTTGTTTGCAATATCTAAA
TTGATAAATTATGGATATCTCTCGCTAAATTAGGAATTAAAAGATTTCTTTGCAAGATTT
AAAGATTAGATTATGAAGTAGTAGTAGCAGTAATAGTAAAAAGAAAAGTAACATAGATCT
AGCAGAAAAAATTAGACTAAAAAAAGACTCAGAGACGCAGCAAAGGAGATAGCTGATAAC
TTAAGCAACAGCATTGATGAAAGATCTAACACTTCTATTTAGTAACCTAGACATATTTCT
ACAGAAGAGAGACTGAATATGCAAGAATAGAATCTGATATCACCTCTCGCTATGATGATT
AATTAAAGATCTGATTTAGATTCAGATAATGAAAATTCAAATACAGGTTTTAGCGATAAT
TTACCTGATCCTAATTAACAAAGACTTATGATGCTTGGAGAGGATAATTTAGCTGGGATA
GAATTTGATGGGGGACTTGGCATGGATACAGGTTTTGATTATGATGGATTTTAGTATGAT
TTTAGTGAACAAGATAGTTAAAGCTAAGGATTCAATAAGGTTAATGGAAATGCTATAAAT
ATCTCCCAAGAATTAAATTAAGTTGGCGACATCTCTGAAAGATATATAAGAAAAATTACC
AATTATGCCAATTAACAATCTTCAAAAAAGAAAAAAAAAACTAAACAAAAATAATAGGGA
CATAACAAAGAAGGCGAGCATGCAATTCTTAATGAAACAGTAGATATGGATAATTAAGAG
TTTTCAAAAGCTATGGATGAAAAATTAAATTAGTTCTATAGTAGCTAATCATAAAGAGTT
AATAAAAATATATCACATATTTCAGATATATCTAGATTATCGACCACATTATAATAGCCA
TCAATATTATCACAAAATTTTAATATCTATGAAGAATCAATCAGCGAAGCACCTTTCTAA
TAAATTAATATATCGAATTATTTAAATGCTTCCACCCTAGTTGACTAACCAATTTTGAAT
CTTACTAAGAAATTTGATGAAGCAATAAGCCTAAAAGAAAATGATAATAATGTGCTCCTT
TCTGAAGAACTTATTTCTAAATTAGAAAAAGCAATGCAAAATATAAATATTGATTTAGTA
AAATAAGACTAAGGTGGAGTGGATATGATGGATTTTAACTAGGATAACTAAGGCGGCTAC
ATGGATTATCCTGATGATTTTGGTAGCTTAGATTAATATAATCAATAAAAAGAAGAATAA
GATGGAGAACTAGAAATTCCTGTTCAAATACCAGAAATATAAAAATCTAAGCTAGAAAAA
GATAAAAAAATTGATGAAATTGATAGTTTATAAGACTTTGATATTACTCCTCTTGATAAA
AAAATTCTTACAGAAGAGGAATAAAGAGTTCTTCAGTAATATGACAAATTATTCACAAAA
TTAAGAGATATCCTAGACAAAGAACCAACTGCTGAGTTTAACGATGTTTATTAATCATTC
AAAAACTAAAAGAGTAAAGCAGAGCTCTTCTACGATATTTTGGAGTTATAAAAGCTTGGT
CAGATTTCTGTTTCTTAAAACGATAATATTCATTTTTCACCAATACAAATTCTTATCAAA
TGA


>TTHERM_00245660(protein)
MMVRQQNNQNTQSQSNITTSVSQYTSEDSQNSQVQRENRNKIILKYDENIAKIVALGMEE
KLIKNQLGKIDISDALVKVSSNVNIFSVKQSANFLFAISKLINYGYLSLNQELKDFFARF
KDQIMKQQQQQQQKEKQHRSSRKNQTKKRLRDAAKEIADNLSNSIDERSNTSIQQPRHIS
TEERLNMQEQNLISPLAMMINQRSDLDSDNENSNTGFSDNLPDPNQQRLMMLGEDNLAGI
EFDGGLGMDTGFDYDGFQYDFSEQDSQSQGFNKVNGNAINISQELNQVGDISERYIRKIT
NYANQQSSKKKKKTKQKQQGHNKEGEHAILNETVDMDNQEFSKAMDEKLNQFYSSQSQRV
NKNISHISDISRLSTTLQQPSILSQNFNIYEESISEAPFQQINISNYLNASTLVDQPILN
LTKKFDEAISLKENDNNVLLSEELISKLEKAMQNINIDLVKQDQGGVDMMDFNQDNQGGY
MDYPDDFGSLDQYNQQKEEQDGELEIPVQIPEIQKSKLEKDKKIDEIDSLQDFDITPLDK
KILTEEEQRVLQQYDKLFTKLRDILDKEPTAEFNDVYQSFKNQKSKAELFYDILELQKLG
QISVSQNDNIHFSPIQILIK


>TTHERM_00245660(gene)
AAAAACGAATTTGAAAATTGTGCAAAAATAATTTGTTTTTAAATCAATATTAAATAAATT
AATGCTAAATAATAATTAGAAACTAATACTCAACATAGATATTTCACAAAAGTAGATATA
ATAAAAAAGGTTAGCAACTTTATTTTAAAAATATTAAGTTTAAAAAATTAAAAGATTAAC
TGTTAATAGATCTAAATGATGGTTAGGCAATAAAATAACTAGAATACACAGAGTTAAAGC
AATATCACAACCAGTGTTAGTCAATATACATCAGAAGATTCCTAAAATTCTTAGGTTCAA
AGAGAAAACAGGAATAAAATAATCTTAAAGTATGATGAAAACATTGCCAAAATAGTTGCT
TTGGGCATGGAAGAAAAGCTCATAAAAAATTAATTGGGAAAAATAGATATATCAGATGCA
CTTGTCAAAGTGAGTAGTAATGTTAACATTTTTAGTGTTAAGTAGAGTGCTAATTTTTTG
TTTGCAATATCTAAATTGATAAATTATGGATATCTCTCGCTAAATTAGGAATTAAAAGAT
TTCTTTGCAAGATTTAAAGATTAGATTATGAAGTAGTAGTAGCAGTAATAGTAAAAAGAA
AAGTAACATAGATCTAGCAGAAAAAATTAGACTAAAAAAAGACTCAGAGACGCAGCAAAG
GAGATAGCTGATAACTTAAGCAACAGCATTGATGAAAGATCTAACACTTCTATTTAGTAA
CCTAGACATATTTCTACAGAAGAGAGACTGAATATGCAAGAATAGAATCTGATATCACCT
CTCGCTATGATGATTAATTAAAGATCTGATTTAGATTCAGATAATGAAAATTCAAATACA
GGTTTTAGCGATAATTTACCTGATCCTAATTAACAAAGACTTATGATGCTTGGAGAGGTA
AAAATAAAATATATTTTTTTTATTTAAACTCAAAAAAATCCTTTAAGAACATTCATTTAT
TATTAAATAAAATCCATGCTTAGTAAATTATTTTTATTAATTAAAAGGATAATTTAGCTG
GGATAGAATTTGATGGGGGACTTGGCATGGATACAGGTTTTGATTATGATGGATTTTAGT
ATGATTTTAGTGAACAAGATAGTTAAAGCTAAGGATTCAATAAGGTTAATGGAAATGCTA
TAAATATCTCCCAAGAATTAAATTAAGTTGGCGACATCTCTGAAAGATATATAAGAAAAA
TTACCAATTATGCCAATTAACAATCTTCAAAAAAGAAAAAAAAAACTAAACAAAAATAAT
AGGGACATAACAAAGAAGGCGAGCATGCAATTCTTAATGAAACAGTAGATATGGATAATT
AAGAGTTTTCAAAAGCTATGGATGAAAAATTAAATTAGTTCTATAGTAGCTAATCATAAA
GAGTTAATAAAAATATATCACATATTTCAGATATATCTAGATTATCGACCACATTATAAT
AGCCATCAATATTATCACAAAATTTTAATATCTATGAAGAATCAATCAGCGAAGCACCTT
TCTAATAAATTAATATATCGAATTATTTAAATGCTTCCACCCTAGTTGACTAACCAATTT
TGAATCTTACTAAGAAATTTGATGAAGCAATAAGCCTAAAAGAAAATGATAATAATGTGC
TCCTTTCTGAAGAACTTATTTCTAAATTAGAAAAAGCAATGCAAAATATAAATATTGATT
TAGTAAAATAAGACTAAGGTGGAGTGGATATGATGGATTTTAACTAGGATAACTAAGGCG
GCTACATGGATTATCCTGATGATTTTGGTAGCTTAGATTAATATAATCAATAAAAAGAAG
AATAAGATGGAGAACTAGAAATTCCTGTTCAAATACCAGAAATATAAAAATCTAAGCTAG
AAAAAGATAAAAAAATTGATGAAATTGATAGTTTATAAGACTTTGATATTACTCCTCTTG
ATAAAAAAATTCTTACAGAAGAGGAATAAAGAGTTCTTCAGTAATATGACAAATTATTCA
CAAAATTAAGAGATATCCTAGACAAAGAACCAACTGCTGAGTTTAACGATGTTTATTAAT
CATTCAAAAACTAAAAGAGTAAAGCAGAGCTCTTCTACGATATTTTGGAGTTATAAAAGC
TTGGTCAGATTTCTGTTTCTTAAAACGATAATATTCATTTTTCACCAATACAAATTCTTA
TCAAATGA