Identifiers and Description

Gene Model Identifier

TTHERM_00094000

Standard Name

RDN2 (Rdr1-associated nucleotidyltransferase)

Aliases

PreTt16555 | 6.m00629 | 3836.m02213

Description

exhibits RNA terminal uridine transferase activity in vitro; involved in 23-24 nt small RNA metabolism

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03828 ) PAP/25A associated domain
  • ( PF01909 ) Nucleotidyltransferase domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00094000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02566.12.0004485223439647e-69hypothetical protein (538 aa)
DictyBaseDDB_G02689140.00000000000009996062864481225DDB_G0268914 on chromosome: 1
position 2371552 to 2385174
OxytrichaContig10883.0.g400.000000000004997916451710233Nucleotidyltransferase domain
WormBaseWBGene000015960.0000000039998859049333245locus:gld-2 Poly(A) RNA poly
merase gld-2 status:Confirme
d UniProt:O17087 protein_i
d:CCD72661.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22706992: Talsky KB, Collins K (2012) Strand-asymmetric endogenous Tetrahymena small RNA production requires a previously uncharacterized uridylyltransferase protein partner. RNA (New York, N.Y.) 18(8):1553-62
  2. Ref:20622019: Talsky KB, Collins K (2010) Initiation by a eukaryotic RNA-dependent RNA polymerase requires looping of the template end and is influenced by the template-tailing activity of an associated uridyltransferase. The Journal of biological chemistry 285(36):27614-23
  3. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  4. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00094000(coding)
ATGGAAGGCGATTTCTTTTAGCAAACATTTCTAAAATATATAAAGTATAGACCAAGCAAG
AATATAAATGTGCATTAGTATTTATTGAAGAAATTAGAAGTTGAGTAATTAAGTTAAAGT
TAATTATTAAGCTTAAAAAATAGTTTAGATGATTTTATTCGTAAATATAATTTTCATAAT
GATGAATGGATTCTAATTAGTCTAATTGAAAATTTAGCACATTCAGACTTATTATTTTCA
AGCGATACTGAAAAATATATTTTAATTATTAAGAAAAGATTCTACCTCAATTTACTGAAT
AAACTTGAGAATAATATTTCAAGTAAATTTGATCTTTAGGAGCTCTAGAAGTGTTTAAAG
TCATTTTACTTAAGCTATAAAAATAATGTTTATGATTTGTTTTTAAATGCTTCAAATGAT
ATTTAAATAATAAAGTAGATAGATAGCAACCTAGGAGAAAAATTAAAAAAAATTGAAAAG
CATGTATCTGAGATTTTAAAGAGGCTTAAAAGTAATGAATCGTAGTAAATGTCTATTAAT
TAGAATGAGTAGAACATCTAATAAAATAAAGAAAATATTAATGAAATAACCAGTAGCAAT
TAATTAGAAATTTTATTAAATTAAATTTATAAGTAAGAAAAGATCAGTATTTAGTTTAAT
GAAGAATTACTTAATCAAGAAGTCAATATGGTAAATTAAATTGTGAGTGAGATGAATTTA
AATAAAATTATTGGGCTATAAAATGTGTATGTTCATCCGTATGGGTCAGTTGTTAGTGGG
TTTGGTTAGAATGATAGTGACATTGATATAAGCATAAATACAGATTGCTATTTAGATGAA
AGAGTATTTCTTTCTCTTATTTATGATTTCATGAAAAATTATTTGCATAAATATAAAATC
AAATATTAAAAACTTGAATTAAAATTAGATGCGCGTATTCCTTTAATAACTCTTGTTAAA
CAGAAAGATAATGTTAATTTGAAAAGTAATACAGTTTCAATAGACATATGTATAAATAAT
CTACTAGGATGCGCAAATTCAAAAATGCTAAAAGTTATATCTTAGATTCATCCCTTAGTA
AAGTAGCTAGGAATAATCATTAAATATTGGGCGAAGTAGAATGGTCTTATAAGCAAAAAA
ACTCTTAGTTCATATGCATTTATCCTCATAATGATCTGCTTTTTATAGAGAAAGAAGCTA
ATTGATCCTTATTTTTAAGAGAAAGTTTAAAAAAGATAAAGTGATCCAAAATATTCTACT
TTGATTAAGAGGACAAAGGAAACTGATTAGGAATTTTAAACAAACCTTTATTATGTGCAA
GATCCCTCGCATTTACAGAAATCTCTAAAAAAGTATAAAGAAAACAATCCAAACTAAAAA
ACTTTATTAGACATGAATCTTGCAAGCTTATTCAGTGAGTTTATTGAATATTACTCAGAC
ACCACTGATGAGAATAGAAGATATATAGATATTATGAATAATTATATAGTAAAATCATAT
AATAAAAATTTATTCTTTTATATTATTGACCCATTTGATAATTATCATAACCCAGGAGAA
AGAAGCAGAGTAGAGAATATAGATGATAACATATTTATAAATAGATTTAGGTTTGCTAAG
TAAAAATTGCAAGACAAACAATATTCGCAAATATTTGAATTAAAATTTCAATGA


>TTHERM_00094000(protein)
MEGDFFQQTFLKYIKYRPSKNINVHQYLLKKLEVEQLSQSQLLSLKNSLDDFIRKYNFHN
DEWILISLIENLAHSDLLFSSDTEKYILIIKKRFYLNLLNKLENNISSKFDLQELQKCLK
SFYLSYKNNVYDLFLNASNDIQIIKQIDSNLGEKLKKIEKHVSEILKRLKSNESQQMSIN
QNEQNIQQNKENINEITSSNQLEILLNQIYKQEKISIQFNEELLNQEVNMVNQIVSEMNL
NKIIGLQNVYVHPYGSVVSGFGQNDSDIDISINTDCYLDERVFLSLIYDFMKNYLHKYKI
KYQKLELKLDARIPLITLVKQKDNVNLKSNTVSIDICINNLLGCANSKMLKVISQIHPLV
KQLGIIIKYWAKQNGLISKKTLSSYAFILIMICFLQRKKLIDPYFQEKVQKRQSDPKYST
LIKRTKETDQEFQTNLYYVQDPSHLQKSLKKYKENNPNQKTLLDMNLASLFSEFIEYYSD
TTDENRRYIDIMNNYIVKSYNKNLFFYIIDPFDNYHNPGERSRVENIDDNIFINRFRFAK
QKLQDKQYSQIFELKFQ


>TTHERM_00094000(gene)
ATGGAAGGCGATTTCTTTTAGCAAACATTTCTAAAATATATAAAGTATAGACCAAGCAAG
AATATAAATGTGCATTAGTATTTATTGAAGAAATTAGAAGTTGAGTAATTAAGTTAAAGT
TAATTATTAAGCTTAAAAAATAGTTTAGATGATTTTATTCGTAAATATAATTTTCATAAT
GATGAATGGATTCTAATTAGTCTAATTGAAAATTTAGCACATTCAGACTTATTATTTTCA
AGCGATACTGAAAAATATATTTTAATTATTAAGAAAAGATTCTACCTCAATTTACTGAAT
AAACTTGAGAATAATATTTCAAGTAAATTTGATCTTTAGGAGCTCTAGAAGTGTTTAAAG
TCATTTTACTTAAGCTATAAAAATAATGTTTATGATTTGTTTTTAAATGCTTCAAATGAT
ATTTAAATAATAAAGTAGATAGATAGCAACCTAGGAGAAAAATTAAAAAAAATTGAAAAG
CATGTATCTGAGATTTTAAAGAGGCTTAAAAGTAATGAATCGTAGTAAATGTCTATTAAT
TAGAATGAGTAGAACATCTAATAAAATAAAGAAAATATTAATGAAATAACCAGTAGCAAT
TAATTAGAAATTTTATTAAATTAAATTTATAAGTAAGAAAAGATCAGTATTTAGTTTAAT
GAAGAATTACTTAATCAAGAAGTCAATATGGTAAATTAAATTGTGAGTGAGATGAATTTA
AATAAAATTATTGGGCTATAAAATGTGTATGTTCATCCGTATGGGTCAGTTGTTAGTGGG
TTTGGTTAGAATGATAGTGACATTGATATAAGCATAAATACAGATTGCTATTTAGATGAA
AGAGTATTTCTTTCTCTTATTTATGATTTCATGAAAAATTATTTGCATAAATATAAAATC
AAATATTAAAAACTTGAATTAAAATTAGATGCGCGTATTCCTTTAATAACTCTTGTTAAA
CAGAAAGATAATGTTAATTTGAAAAGTAATACAGTTTCAATAGACATATGTATAAATAAT
CTACTAGGATGCGCAAATTCAAAAATGCTAAAAGTTATATCTTAGATTCATCCCTTAGTA
AAGTAGCTAGGAATAATCATTAAATATTGGGCGAAGTAGAATGGTCTTATAAGCAAAAAA
ACTCTTAGTTCATATGCATTTATCCTCATAATGATCTGCTTTTTATAGAGAAAGAAGCTA
ATTGATCCTTATTTTTAAGAGAAAGTTTAAAAAAGATAAAGTGATCCAAAATATTCTACT
TTGATTAAGAGGACAAAGGAAACTGATTAGGAATTTTAAACAAACCTTTATTATGTGCAA
GATCCCTCGCATTTACAGAAATCTCTAAAAAAGTATAAAGAAAACAATCCAAACTAAAAA
ACTTTATTAGACATGAATCTTGCAAGCTTATTCAGTGAGTTTATTGAATATTACTCAGAC
ACCACTGATGAGAATAGAAGATATATAGATATTATGAATAATTATATAGTAAAATCATAT
AATAAAAATTTATTCTTTTATATTATTGACCCATTTGATAATTATCATAACCCAGGAGAA
AGAAGCAGAGTAGAGAATATAGATGATAACATATTTATAAATAGATTTAGGTTTGCTAAG
TAAAAATTGCAAGACAAACAATATTCGCAAATATTTGAATTAAAATTTCAATGA