Identifiers and Description

Gene Model Identifier

TTHERM_00094040

Standard Name

RDN1 (Rdr1-associated nucleotidyltransferase 1)

Aliases

PreTt16559 | 6.m00633 | 3836.m02217

Description

associated with Rdr1; exhibits terminal RNA uridine transferase activity in vitro

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03828 ) PAP/25A associated domain
  • ( PF01909 ) Nucleotidyltransferase domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00094040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02566.11.000008670162283e-147hypothetical protein (538 aa)
OxytrichaContig10883.0.g400.00000000000020009182674645818Nucleotidyltransferase domain
DictyBaseDDB_G02784250.000000000010004361180063202DDB_G0278425 on chromosome: 3
position 866714 to 870080
WormBaseWBGene000092840.0000000020002373268528243status:Partially_confirmed U
niProt:G5EFM8 protein_id:CAB
07197.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22706992: Talsky KB, Collins K (2012) Strand-asymmetric endogenous Tetrahymena small RNA production requires a previously uncharacterized uridylyltransferase protein partner. RNA (New York, N.Y.) 18(8):1553-62
  2. Ref:20622019: Talsky KB, Collins K (2010) Initiation by a eukaryotic RNA-dependent RNA polymerase requires looping of the template end and is influenced by the template-tailing activity of an associated uridyltransferase. The Journal of biological chemistry 285(36):27614-23
  3. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74

Sequences

>TTHERM_00094040(coding)
ATGAATATTAATTTGACTGATAAGTAAAAAATATATAGCAATGTCATCAAAAATGCATTA
GAAAAAATTTACAAAAATGATAAAGTAGATATTTTAAACTTAATTAATACAAGCTTGGGC
TGTTAGACTATAGAAATTAAATACGATGTGGAATTCCACTAGTTACTTGCTCAATATTTT
CAAAATATGCGTTATTAAGATACAAAGGATAAAGAAGATGTGCTTTAAAAACTGCTTGAG
TAATGCCTCAGTCAAAATCTAATTTTAAATACTTAAAAAAGTAAACTTTCTAAACAAATC
ATCATTTTGAAGCGCCTAAGAAGAATTTAATAAAAGCTTAAGGATGACCCAAAAAATGCT
TTGGATCATTTGATAGAAGAATACGACTAAGAGGAGGAAAATTGTGATGAAGAAGTGCTA
TTATAGCGTTTCGAATAGGATAAAACAGACTTAAGAATGCAAATAGAAGACAATGTTAAA
GATTTAAAAAAAGAAAATATAAAATATCTGTTGTTGAAAAAATAAAATAATTAAGAAAAA
AATATTTAAAATGAATAAAATTTAGAATAAATTCTTTTAGATGTATATAATCAGCAAAAA
ATTGAAGAGAGTTTCTCAAAAAGACTTCTATAAGAAGTTAATTTTATCAGAAAGATCATT
AGTATGATGAGGCTTAAGGAGTTATTTGGCTTAGAGTATGTCACAGTATAGCCTTATGGT
TCTATAGTTAGTGGATTTGCTTAAAAATCTAGCGATGTTGATATCAGTATTAATACTAAC
TGCTATATAGATGAGAGCTCATTTATATAACTTCTTCATAACTTCATAAAGCAGTATTGC
AGTAATAAATCAATTAAGAATGTTGAAACTGAGCCAGTTCTTCAGGCCTAAACTCCGTTG
CTCAAATACACAAGGAAAGATACAGTAGATCAATAATAAATAAAAATAGATATAGATATT
TGTGTTAACAATATCTTGGGATGCACTAATTCATTAATGCTTTACACTCTTTCCTAACTG
CATCCAAAAATTTAATAATTAGGAATTATCATTAAACACTGGGCTAAGTAAAGAGGTGTA
TCCAGTAAAAGTCACTTATCCTCCTATTCCTTTATTTTGATGATGTTTTCCTTCCTTTTC
AGAGAAAAGATATTGAACTCAGAGTTTGTCAAAAAAAGTAAAAGTAAAGAAAATTAGTGT
TAAGTCAAAATTAAAAGAAAAAAAAAGGATGGTGAATAAATATTTTAAACTAATTTATAC
TTTTATAGCAATGTAGAAGACTTAAAAATGAAATTAGCTATATGGAGAAAAGAAAAAAAC
TTGCCTTCCTTAGATGATGTATCACTAAGCTAACTTTTTATAGATTTTATAAAATTCTAT
TAATCTAGCTTTAATTTTAAAGACAAGAGGTTTATTTCCATTTTTAACTTTGATGTCAAT
TACAGCAATAACAATTTTAAATATGAACTTTATGATGAAAATTATTACTTCAATATTGAA
GATCCATTTGATACTAAGCACAATCCTGGATAAAAAACTCAAAACAAATAAGAATAATAT
AAACAGGCCTTTGATGATGCTTTAAATTAAATTGAAAGTAAGTAATATAATCTGCTATTC
TCATCTAAATGA


>TTHERM_00094040(protein)
MNINLTDKQKIYSNVIKNALEKIYKNDKVDILNLINTSLGCQTIEIKYDVEFHQLLAQYF
QNMRYQDTKDKEDVLQKLLEQCLSQNLILNTQKSKLSKQIIILKRLRRIQQKLKDDPKNA
LDHLIEEYDQEEENCDEEVLLQRFEQDKTDLRMQIEDNVKDLKKENIKYLLLKKQNNQEK
NIQNEQNLEQILLDVYNQQKIEESFSKRLLQEVNFIRKIISMMRLKELFGLEYVTVQPYG
SIVSGFAQKSSDVDISINTNCYIDESSFIQLLHNFIKQYCSNKSIKNVETEPVLQAQTPL
LKYTRKDTVDQQQIKIDIDICVNNILGCTNSLMLYTLSQLHPKIQQLGIIIKHWAKQRGV
SSKSHLSSYSFILMMFSFLFREKILNSEFVKKSKSKENQCQVKIKRKKKDGEQIFQTNLY
FYSNVEDLKMKLAIWRKEKNLPSLDDVSLSQLFIDFIKFYQSSFNFKDKRFISIFNFDVN
YSNNNFKYELYDENYYFNIEDPFDTKHNPGQKTQNKQEQYKQAFDDALNQIESKQYNLLF
SSK


>TTHERM_00094040(gene)
ATGAATATTAATTTGACTGATAAGTAAAAAATATATAGCAATGTCATCAAAAATGCATTA
GAAAAAATTTACAAAAATGATAAAGTAGATATTTTAAACTTAATTAATACAAGCTTGGGC
TGTTAGACTATAGAAATTAAATACGATGTGGAATTCCACTAGTTACTTGCTCAATATTTT
CAAAATATGCGTTATTAAGATACAAAGGATAAAGAAGATGTGCTTTAAAAACTGCTTGAG
TAATGCCTCAGTCAAAATCTAATTTTAAATACTTAAAAAAGTAAACTTTCTAAACAAATC
ATCATTTTGAAGCGCCTAAGAAGAATTTAATAAAAGCTTAAGGATGACCCAAAAAATGCT
TTGGATCATTTGATAGAAGAATACGACTAAGAGGAGGAAAATTGTGATGAAGAAGTGCTA
TTATAGCGTTTCGAATAGGATAAAACAGACTTAAGAATGCAAATAGAAGACAATGTTAAA
GATTTAAAAAAAGAAAATATAAAATATCTGTTGTTGAAAAAATAAAATAATTAAGAAAAA
AATATTTAAAATGAATAAAATTTAGAATAAATTCTTTTAGATGTATATAATCAGCAAAAA
ATTGAAGAGAGTTTCTCAAAAAGACTTCTATAAGAAGTTAATTTTATCAGAAAGATCATT
AGTATGATGAGGCTTAAGGAGTTATTTGGCTTAGAGTATGTCACAGTATAGCCTTATGGT
TCTATAGTTAGTGGATTTGCTTAAAAATCTAGCGATGTTGATATCAGTATTAATACTAAC
TGCTATATAGATGAGAGCTCATTTATATAACTTCTTCATAACTTCATAAAGCAGTATTGC
AGTAATAAATCAATTAAGAATGTTGAAACTGAGCCAGTTCTTCAGGCCTAAACTCCGTTG
CTCAAATACACAAGGAAAGATACAGTAGATCAATAATAAATAAAAATAGATATAGATATT
TGTGTTAACAATATCTTGGGATGCACTAATTCATTAATGCTTTACACTCTTTCCTAACTG
CATCCAAAAATTTAATAATTAGGAATTATCATTAAACACTGGGCTAAGTAAAGAGGTGTA
TCCAGTAAAAGTCACTTATCCTCCTATTCCTTTATTTTGATGATGTTTTCCTTCCTTTTC
AGAGAAAAGATATTGAACTCAGAGTTTGTCAAAAAAAGTAAAAGTAAAGAAAATTAGTGT
TAAGTCAAAATTAAAAGAAAAAAAAAGGATGGTGAATAAATATTTTAAACTAATTTATAC
TTTTATAGCAATGTAGAAGACTTAAAAATGAAATTAGCTATATGGAGAAAAGAAAAAAAC
TTGCCTTCCTTAGATGATGTATCACTAAGCTAACTTTTTATAGATTTTATAAAATTCTAT
TAATCTAGCTTTAATTTTAAAGACAAGAGGTTTATTTCCATTTTTAACTTTGATGTCAAT
TACAGCAATAACAATTTTAAATATGAACTTTATGATGAAAATTATTACTTCAATATTGAA
GATCCATTTGATACTAAGCACAATCCTGGATAAAAAACTCAAAACAAATAAGAATAATAT
AAACAGGCCTTTGATGATGCTTTAAATTAAATTGAAAGTAAGTAATATAATCTGCTATTC
TCATCTAAATGA