Identifiers and Description

Gene Model Identifier

TTHERM_01207570

Standard Name

RDF2 (Rdr1-associated factor 2)

Aliases

PreTt09111 | 274.m00028

Description

Associates with Rdr1; involved in 23-24 nt small RNA metabolism

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01207570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20940.11.9996410647472548e-29hypothetical protein (615 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32
  2. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74

Sequences

>TTHERM_01207570(coding)
ATGAGTATGAATAGATTAGAGAAATTCAAAATGGAGCATATGCTGGAAAAACCATTAATA
AAAAGATAGTATTCTGTCTACAAAGTTTATGAAATGAACTAATCTTATAGTTAAAATTCT
GATAACAACTTTTGTATTTGTATGCTTAATGAGTAAAGCAAAGCTAAAATACTTTTTTTA
TTATCGATTGCAGAAACTAAATAATTTCAGGTCTTATCATACCGAAATTAAAATGTAGAA
AATGAAAAACTTAGTTAGATAACAGACATAGTAAAAATTAATGATGATACTGTAGTATGC
TCTCATTATGATGGATCCTTGGTTATTTATAAAAATTTTAAAGAAAGAAAATTTAAATAT
AATGAAGAAGAGTATAAAGAAATAATTCCAGCACAAGTGAAAGATATATCAGATATCAAT
AATGCTATATTATTTATTTCAGTCTTTAAAAAATAAAATTAATTAATAATAATGCTAGAA
TATTATGATGGATAAGTAATGGAATTACATTCAAGTTTAAGTAACATTTAATTCGTTCAT
AAGTAGGTACGTAGAGAAAAATAAAATTTCACTCATAGAAAGTTTTTAAAGGAAGAGTAA
GTTCTGTGTGGATTTATTGATTAATCAAAATTTGGTATTATTGAAGCAAGCTAAGATATT
TAATTAAAGTTATTAGAAATGAAAACTTATGATATGGATGAAGATACCAAATAACTCTTA
AAGATGTCTACCCTTAAATTGATTACTTTTGATACTCATTAACATAATTAAATACTCTAT
ATTGTCTGCATCTATGAAAATTATGATAGGTAGCAAATATTATGCTCTTTTAAGCTCGAC
AGGACAAACTGTTAACCTCAAAATGAAATAACTCTTAATCTAATAACTAGTTTCACACTA
AATGTTGATCTAGGAGAAGCAGTTCAAATAATTTCAATTAATCAAAATCAAAGAAGGTGC
TTTTAATATGATGTAATTGTATTATTTTAACATAAATTAATGGCCTATAGTTGGCAAAAT
GAAATTGATGAAGCCTTAATTATCAAAGATAATGATGAAGAATATAAAATATATCATTTT
TAAGTAATTGAAGATATGCCATACCATTTACTTATATCCTAAATCGAAGATAAGTAAAGG
ATCCAATATTTTTGCACATATATTTGA


>TTHERM_01207570(protein)
MSMNRLEKFKMEHMLEKPLIKRQYSVYKVYEMNQSYSQNSDNNFCICMLNEQSKAKILFL
LSIAETKQFQVLSYRNQNVENEKLSQITDIVKINDDTVVCSHYDGSLVIYKNFKERKFKY
NEEEYKEIIPAQVKDISDINNAILFISVFKKQNQLIIMLEYYDGQVMELHSSLSNIQFVH
KQVRREKQNFTHRKFLKEEQVLCGFIDQSKFGIIEASQDIQLKLLEMKTYDMDEDTKQLL
KMSTLKLITFDTHQHNQILYIVCIYENYDRQQILCSFKLDRTNCQPQNEITLNLITSFTL
NVDLGEAVQIISINQNQRRCFQYDVIVLFQHKLMAYSWQNEIDEALIIKDNDEEYKIYHF
QVIEDMPYHLLISQIEDKQRIQYFCTYI


>TTHERM_01207570(gene)
ATGAGTATGAATAGATTAGAGAAATTCAAAATGGAGCATATGCTGGAAAAACCATTAATA
AAAAGATAGTATTCTGTCTACAAAGTTTATGAAATGAACTAATCTTATAGTTAAAATTCT
GATAACAACTTTTGTATTTGTATGCTTAATGAGTAAAGCAAAGCTAAAATACTTTTTTTA
TTATCGATTGCAGAAACTAAATAATTTCAGGTCTTATCATACCGAAATTAAAATGTAGAA
AATGAAAAACTTAGTTAGATAACAGACATAGTAAAAATTAATGATGATACTGTAGTATGC
TCTCATTATGATGGATCCTTGGTTATTTATAAAAATTTTAAAGAAAGAAAATTTAAATAT
AATGAAGAAGAGTATAAAGAAATAATTCCAGCACAAGTGAAAGATATATCAGATATCAAT
AATGCTATATTATTTATTTCAGTCTTTAAAAAATAAAATTAATTAATAATAATGCTAGAA
TATTATGATGGATAAGTAATGGAATTACATTCAAGTTTAAGTAACATTTAATTCGTTCAT
AAGTAGGTACGTAGAGAAAAATAAAATTTCACTCATAGAAAGTTTTTAAAGGAAGAGTAA
GTTCTGTGTGGATTTATTGATTAATCAAAATTTGGTATTATTGAAGCAAGCTAAGATATT
TAATTAAAGTTATTAGAAATGAAAACTTATGATATGGATGAAGATACCAAATAACTCTTA
AAGATGTCTACCCTTAAATTGATTACTTTTGATACTCATTAACATAATTAAATACTCTAT
ATTGTCTGCATCTATGAAAATTATGATAGGTAGCAAATATTATGCTCTTTTAAGCTCGAC
AGGACAAACTGTTAACCTCAAAATGAAATAACTCTTAATCTAATAACTAGTTTCACACTA
AATGTTGATCTAGGAGAAGCAGTTCAAATAATTTCAATTAATCAAAATCAAAGAAGGTGC
TTTTAATATGATGTAATTGTATTATTTTAACATAAATTAATGGCCTATAGTTGGCAAAAT
GAAATTGATGAAGCCTTAATTATCAAAGATAATGATGAAGAATATAAAATATATCATTTT
TAAGTAATTGAAGATATGCCATACCATTTACTTATATCCTAAATCGAAGATAAGTAAAGG
ATCCAATATTTTTGCACATATATTTGA