Identifiers and Description

Gene Model Identifier

TTHERM_001207561

Standard Name

RDF1 (RDr1-associated Factor 1)

Aliases

None

Description

RNA-dependent RNA polymerase-associated factor 1, RDF1 hypothetical protein; Associated with Rdr1; component of RDRC complex in RNAi pathway; involved in 23-24 nucleotide RNA metabolism

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_001207561

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  2. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_001207561(coding)
ATGTAGTCTTATTAAAGTTCTGAAAGACTTAGTATTCAGCTTTAAATTTCTCTGATAAAA
TATGATAAAATTTTACTAAATGAAGGATTAATAAATGCTTACAATCCAATATATACTATT
ATTTAAGTAAACTGTAATTAAGAAAATGCTATTTTATAATCTCAAGTATTACCTGATATT
ATGGACTTAGATTTAATACAAATGACTTATCAAAAGAATGCTTATTTACTTAAATGTAAT
AATAAAGGTTAAATTCTTTTTTCAGGAAAGCAAATTGATCAAAAGTATTAATTTATTTTT
AATGATAAGTTTGAAGTTGCGATTGATAAACTAGCATTTATTTCTGGATAATCATTCTTA
TTTTTTTTAGACAAGGAAAAAAATGTTTCCACTCTCTAATTCTTAGGATAATCATAATAA
AAATATTCAAAATAAATACATTCAAAAGTAGATTTCTTGATTGGTTCTAAGGATTAGAGC
TCTGTATTATTAGTTGATGAGTTTAGGAGGTTTATTATTTATGATTAAAGTGTTTTTAAA
AATGTAAATTAACTTTCTCCGCTATAATTAGAAATAGATTCTAGCTAAAAATAACTATTA
TAGGAAGATAATGAAAGGATTTTAAGTTCTATTTAAAGTATTGATTATATCTAGCATGAA
GCAGGATATTTTATTTATCTAGCAAGTTAACAGTATCTATACAAACTTAATTATCATAGA
GATAATGAGGGAATATAAGTAAATTAAATAATAAGAATTGACTAAAGTAGAGGCAAAGTT
TAAAAAATTGTTGCATTAAATTCAAATTAAGGAAAATATTTTGAAGTAGTTGTAGTGCAG
TAAAAAAGTGTTGACTAATACTTGTTTACATAAAAATTCAGTACTAAAAATTTATGGAAA
AGCAATGATGATAGTGATAAAATTGCATTTGATTACACTTACAAAACCAAAAATAGTACA
TATTATCATATAATTTAATGTGTTTCCTAACAAGAACTTTATAAAAATAAATAAAACTAG
CTAGAATTTAATAAATCTTATGTTTTTGTTACTAAAGATTGA


>TTHERM_001207561(protein)
MQSYQSSERLSIQLQISLIKYDKILLNEGLINAYNPIYTIIQVNCNQENAILQSQVLPDI
MDLDLIQMTYQKNAYLLKCNNKGQILFSGKQIDQKYQFIFNDKFEVAIDKLAFISGQSFL
FFLDKEKNVSTLQFLGQSQQKYSKQIHSKVDFLIGSKDQSSVLLVDEFRRFIIYDQSVFK
NVNQLSPLQLEIDSSQKQLLQEDNERILSSIQSIDYIQHEAGYFIYLASQQYLYKLNYHR
DNEGIQVNQIIRIDQSRGKVQKIVALNSNQGKYFEVVVVQQKSVDQYLFTQKFSTKNLWK
SNDDSDKIAFDYTYKTKNSTYYHIIQCVSQQELYKNKQNQLEFNKSYVFVTKD


>TTHERM_001207561(gene)
ATGTAGTCTTATTAAAGTTCTGAAAGACTTAGTATTCAGCTTTAAATTTCTCTGATAAAA
TATGATAAAATTTTACTAAATGAAGGATTAATAAATGCTTACAATCCAATATATACTATT
ATTTAAGTAAACTGTAATTAAGAAAATGCTATTTTATAATCTCAAGTATTACCTGATATT
ATGGACTTAGATTTAATACAAATGACTTATCAAAAGAATGCTTATTTACTTAAATGTAAT
AATAAAGGTTAAATTCTTTTTTCAGGAAAGCAAATTGATCAAAAGTATTAATTTATTTTT
AATGATAAGTTTGAAGTTGCGATTGATAAACTAGCATTTATTTCTGGATAATCATTCTTA
TTTTTTTTAGACAAGGAAAAAAATGTTTCCACTCTCTAATTCTTAGGATAATCATAATAA
AAATATTCAAAATAAATACATTCAAAAGTAGATTTCTTGATTGGTTCTAAGGATTAGAGC
TCTGTATTATTAGTTGATGAGTTTAGGAGGTTTATTATTTATGATTAAAGTGTTTTTAAA
AATGTAAATTAACTTTCTCCGCTATAATTAGAAATAGATTCTAGCTAAAAATAACTATTA
TAGGAAGATAATGAAAGGATTTTAAGTTCTATTTAAAGTATTGATTATATCTAGCATGAA
GCAGGATATTTTATTTATCTAGCAAGTTAACAGTATCTATACAAACTTAATTATCATAGA
GATAATGAGGGAATATAAGTAAATTAAATAATAAGAATTGACTAAAGTAGAGGCAAAGTT
TAAAAAATTGTTGCATTAAATTCAAATTAAGGAAAATATTTTGAAGTAGTTGTAGTGCAG
TAAAAAAGTGTTGACTAATACTTGTTTACATAAAAATTCAGTACTAAAAATTTATGGAAA
AGCAATGATGATAGTGATAAAATTGCATTTGATTACACTTACAAAACCAAAAATAGTACA
TATTATCATATAATTTAATGTGTTTCCTAACAAGAACTTTATAAAAATAAATAAAACTAG
CTAGAATTTAATAAATCTTATGTTTTTGTTACTAAAGATTGA