Identifiers and Description

Gene Model Identifier

TTHERM_00361720

Standard Name

RCL1 (RNA terminal phosphate cyclase RCL1)

Aliases

PreTt13387 | 38.m00222

Description

RNA 3'-terminal phosphate cyclase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR03399 ) RNA 3'-phosphate cyclase
  • ( PF01137 ) RNA 3'-terminal phosphate cyclase
  • ( TIGR03400 ) 18S rRNA biogenesis protein RCL1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00361720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01321.11.0002211124116698e-173RNA 3-terminal phosphate cycla
se (374 aa)
DictyBaseDDB_G02761593.9990760533890984e-36rtc1 on chromosome: 2 position
6274208 to 6275509
Stentor CoeruleusSteCoe_384080.000000000000004658886145103398
OxytrichaContig3020.0.g290.0000000010002658722841845RNA 3-terminal phosphate cycla
se
SGDYOL010W0.000000009996807949091551RCL1 Subunit of U3-containing
90S preribosome processome com
plex involved in 18S rRNA biog
enesis and small ribosomal sub
unit assembly; stimulates Bms1
p GTPase and U3 binding activi
ty; similar to RNA cyclase-lik
e proteins but no activity det
ected

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00361720(coding)
ATGGTAGACGTAGTATATCTTTAAATAGATGGTTCTCTTCATGAAGGAGGAGGTTAGATA
ATCAGATCAAGCATGGCTCTTAGCAATATCTTATAAAAGCCTATTCAATTAAAAAATATA
AGAGTTAACCGACCAAATCCTGGATTGAATAATTAGCTTATGGGAGCTATTAAATTGATG
AGAGAAATCTCTAAAGCATAGGTAGTAGGTGATAAATAAAAATCATTGAAGATCACTTAT
GAACCTTAGATGAAAATTAAAAGCGGAAATTATGCAGGAGGATCTTAGAGTGCAGCTGCC
ATAAGTCTCATGGTTTAATCTTTAATTCCTACTATGATTTTTGGAAAAGCCTAGTCAACT
ATTAAACTTTAGGGTGGTAGTGATGTAAACAAATCTCCTCCATTTGAAACAATACAAAGA
ATTCTAAAGCCACTTTTAGAAAAAATGGGAATTCATTTTAATTACAATTTAATCACAGAA
GGTTACTACCCAAGAGGTGGTGGATAGATTTAATTAGAAGTATAGCCAATTGCTGATTAC
ATAAAGCCTATTACTATAACAAAACGCACTGTTATAAATAAAATTTATTTGCAATTTATT
TTGACTGAAACATGTGAAAAAGCTTAAAAAGATTATTTTAGACCTTTGAAAAAAGACATA
ATAAGCTTCTTAGTAAGTAAATAGCCTGGAATTAAAGAGGAAGATATTGAATTTGAAGTA
GATGTAAAGCAAATAAAAAACAAAAAATATAAAGAATGTTACTCTATTGTTGCTCATGCA
TATGGATCTGAAGATAATTATTTTGCTTTTTCTTTTTACAATGATGATGATCTAAAAGTC
GAAGTAATTATTTTATTAATACTAATAATATTAAATGATGTTTTTACTAGGATGCATCAC
AAAAAGTTTATGAAAACTTTGTTAAAGAACTTTCAGAAGGAGGCTGTTTAGATGAATACC
ATTAAGACTAATTATTATTGTACATGGCATTAGCTAATGGAGAGTCTCAAATTAGAGTAA
ACCCAGCTATCACAGATCACTCTTTAGCTTGCTTTTACGTACTTAAAGAATTTATCCCAG
AAGTAAAAATTGATGTAATTGATGAAGAAGTAGCTGGTCTTAGATCTAAAATTATCAAAA
TTGTAGGAGTAGGTTTTAAAAACGAATGAACAAGTTTTAAATTAAACTTGCTAAAATAAA
TTAATAAAAATATTTATTTATTTATAAAAAAAAATTAACATAAATAAAGATATATTTATA
ATAATTTTGGTTTTTATATTCAATAAACTTTAAATTGTATAATAAAACAAACAAATTGAA
TGCTACATGTAAAATAAATTAATTAATAATAAACCTCTATACTTATATAATATATAGCCT
CTTAGCATATAATTTCCATAAGAGGATTTATTTATATTTTTAATTGAGCTAGAAAGGGTT
TTTTTGGTTATATTTTTTTTAAAAAAACTCAAATAAATTTTTTAGAAATAACTCACTTAT
TTAAAAAATTAGATTTGA


>TTHERM_00361720(protein)
MVDVVYLQIDGSLHEGGGQIIRSSMALSNILQKPIQLKNIRVNRPNPGLNNQLMGAIKLM
REISKAQVVGDKQKSLKITYEPQMKIKSGNYAGGSQSAAAISLMVQSLIPTMIFGKAQST
IKLQGGSDVNKSPPFETIQRILKPLLEKMGIHFNYNLITEGYYPRGGGQIQLEVQPIADY
IKPITITKRTVINKIYLQFILTETCEKAQKDYFRPLKKDIISFLVSKQPGIKEEDIEFEV
DVKQIKNKKYKECYSIVAHAYGSEDNYFAFSFYNDDDLKVEVIILLILIILNDVFTRMHH
KKFMKTLLKNFQKEAVQMNTIKTNYYCTWHQLMESLKLEQTQLSQITLQLAFTYLKNLSQ
KQKLMQLMKKQLVLDLKLSKLQEQVLKTNEQVLNQTCQNKLIKIFIYLQKKININKDIFI
IILVFIFNKLQIVQQNKQIECYMQNKLINNKPLYLYNIQPLSIQFPQEDLFIFLIELERV
FLVIFFLKKLKQIFQKQLTYLKNQI


>TTHERM_00361720(gene)
ATGGTAGACGTAGTATATCTTTAAATAGATGGTTCTCTTCATGAAGGAGGAGGTTAGGTA
TATAAGTTATTAGTACATTTTATTTGGTATTGAATCATTATCGTGAAATTTAATTAGATA
ATCAGATCAAGCATGGCTCTTAGCAATATCTTATAAAAGCCTATTCAATTAAAAAATATA
AGAGTTAACCGACCAAATCCTGGATTGAATAATTAGCTTATGGGAGCTGTAAAAGATAAT
TACAAAATCATTTGAATATTACAATAAATTATATTTTTAGATTAAATTGATGAGAGAAAT
CTCTAAAGCATAGGTAGTAGGTGATAAATAAAAATCATTGAAGATCACTTATGAACCTTA
GATGAAAATTAAAAGCGGTATATAAAATAATCAAAAATTAGGTTGAAATAACTAAATAGT
TAGTGTTTTATATACAGGAAATTATGCAGGAGGATCTTAGAGTGCAGCTGCCATAAGTCT
CATGGTTTAATCTTTAATTCCTACTATGATTTTTGGAAAAGCCTAGTCAACTATTAAACT
TTAGGTAGAATATTAAAATTTATATATCAAATAAAGATATGCTTGCATTCCTCTACTAAT
TTAATAGACTCTTTTAAAACTAACAAATTAGTAAACAAAAAAGAGATAAAATCTTAATTT
AATTTAAATTAATTAATAATATTTGCAAAAAAAATAGACATTTAACAATATTATAATTAC
ACTTTTACAATTTCTAAATAATGTTTTTATTTATAAAAATTATTTTAGGGTGGTAGTGAT
GTAAACAAATCTCCTCCATTTGAAACAATACAAAGAATTCTAAAGCCACTTTTAGAAAAA
ATGGGAATTCATTTTAATTACAATTTAATCACAGAAGGTTACTACCCAAGAGGTGGTGGA
TAGATTTAATTAGAAGTATAGCCAATTGCTGATTACATAAAGCCTATTACTATAACAAAA
CGCACTGTTATAAATAAAATTTATTTGCAATTTATTTTGACTGAAACATGTGAAAAAGCT
TAAAAAGATTATTTTAGACCTTTGAGTAAGAAAATTAAATTTATTTAATGAATTGAATGT
TAAAGTGGTGTTAAAAAAGCAAACTTAAATTATTAAAAACAGAAAAAGACATAATAAGCT
TCTTAGTAAGTAAATAGCCTGGAATTAAAGAGGAAGATATTGAATTTGAAGTAGATGTAA
AGCAAATAAAAAACAAAAAATATAAAGAATGTTACTCTATTGTTGCTCATGCATATGGAT
CTGAAGATAATTATTTTGCTTTTTCTTTTTACAATGATGATGATCTAAAAGTCGAAGTAA
TTATTTTATTAATACTAATAATATTAAATGATGTTTTTACTAGGATGCATCACAAAAAGT
TTATGAAAACTTTGTTAAAGAACTTTCAGAAGGAGGCTGTTTAGATGAATACCATTAAGA
CTAAGTAATACTTTTATTTATTTATTTATTTATATTTTAACTTTAATTTTTTTTGTTAAA
GTTATTATTGTACATGGCATTAGCTAATGGAGAGTCTCAAATTAGAGTAAACCCAGCTAT
CACAGATCACTCTTTAGCTTGCTTTTACGTACTTAAAGAATTTATCCCAGAAGTAAAAAT
TGATGTAATTGATGAAGAAGTAGCTGGTCTTAGATCTAAAATTATCAAAATTGTAGGAGT
AGGTTTTAAAAACGAATGAACAAGTTTTAAATTAAACTTGCTAAAATAAATTAATAAAAA
TATTTATTTATTTATAAAAAAAAATTAACATAAATAAAGATATATTTATAATAATTTTGG
TTTTTATATTCAATAAACTTTAAATTGTATAATAAAACAAACAAATTGAATGCTACATGT
AAAATAAATTAATTAATAATAAACCTCTATACTTATATAATATATAGCCTCTTAGCATAT
AATTTCCATAAGAGGATTTATTTATATTTTTAATTGAGCTAGAAAGGGTTTTTTTGGTTA
TATTTTTTTTAAAAAAACTCAAATAAATTTTTTAGAAATAACTCACTTATTTAAAAAATT
AGATTTGA