Identifiers and Description

Gene Model Identifier

TTHERM_00046320

Standard Name

RBN1 (Regulator of Both Nuclear and cortical organization 1 )

Aliases

PreTt11111 | 3.m01926 | 3824.m02872

Description

Protein of unknown function; may act as a regulator of nuclear function and cortical organization

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00046320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01819.11.000295666700457e-168hypothetical protein (301 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00046320(coding)
ATGTAATTCAGGTCTTGTTACAACCTTCTGAGGAAGAAATTCTCATCTGTATAGTTTGCA
GAATCAAGTTACTTTTAGGATATTAAGTAAGATTGCTAAAGAGCATTGGTTAATTAAAAC
CCTAGAGATTCAGCTTTCATGATTTAGAAGATATACAAATCCATAAATAATAATGAGCAA
TAATTAAAAGATGAAATTTTAAATTGTCATGTTAATAATAACTACTAAGGATAGACATAT
GATTTTCCTGAAAATGTCTAATCATCAAGCGTTAAAGATATAAATTAATTTTTAAAAGAC
AATAAAATTAGTAAAAATATATAACTGCTTCATTCCCTTGCTCATATTGAATATAACGCA
ATGAAGAGTTATCTTGACACTTCTATTAGATTTCTAGATAATGTAAAAAGTGAGTAAAAA
TTTGAGTTTTTTAAAGATATAATGAGAGTATCTTGTGAAGAATCTGAACATTTTATTCTT
TTATCAGACAGACTAAGTCAAGATAACATAATTTATGGCGATATTCCTGTCCATACAGGT
CTGATTGATAATGTTAAAAATTCAATTAACTGCCCTCTTACAAGAATAGCTCTAATTTCT
ATTGTATAAGAAGGTAAAGGTGTAGATTCAGGGGATAGACTTTTAGTTAAATTAATTTCA
TTCTAAGATAAAATAGGAGCTAAAATATTACAAAGAATTTTAGATGAAGAAGTTGGCCAT
ATAGGTATTGGAAATAAATGGTTTTAGATCATTTGCAAAAATTAAAATATAGACCCTATT
ATAAAATTTAAAGAAATATGCTAAAATCATGGAGTTAAATTCTTTAAGCCTTATAATAAA
GAAGCTAGAATTAAAGCTGGTTATGATGAAAATTGGATATAAAAAATTTGGGAAGAAAAT
TGA


>TTHERM_00046320(protein)
MQFRSCYNLLRKKFSSVQFAESSYFQDIKQDCQRALVNQNPRDSAFMIQKIYKSINNNEQ
QLKDEILNCHVNNNYQGQTYDFPENVQSSSVKDINQFLKDNKISKNIQLLHSLAHIEYNA
MKSYLDTSIRFLDNVKSEQKFEFFKDIMRVSCEESEHFILLSDRLSQDNIIYGDIPVHTG
LIDNVKNSINCPLTRIALISIVQEGKGVDSGDRLLVKLISFQDKIGAKILQRILDEEVGH
IGIGNKWFQIICKNQNIDPIIKFKEICQNHGVKFFKPYNKEARIKAGYDENWIQKIWEEN


>TTHERM_00046320(gene)
ATGTAATTCAGGTCTTGTTACAACCTTCTGAGGAAGAAATTCTCATCTGTATAGTTTGCA
GAATCAAGTTACTTTTAGGATATTAAGTAAGATTGCTAAAGAGCATTGGTTAATTAAAAC
CCTAGAGATTCAGCTTTCATGATTTAGAAGATATACAAATCCATAAATAATAATGAGCAA
TAATTAAAAGATGAAATTTTAAATTGTCATGTTAATAATAACTACTAAGGATAGACATAT
GATTTTCCTGAAAATGTCTAATCATCAAGCGTTAAAGATATAAATTAATTTTTAAAAGAC
AATAAAATTAGTAAAAATATATAACTGCTTCATTCCCTTGCTCATATTGAATATAACGCA
ATGAAGAGTTATCTTGACACTTCTATTAGATTTCTAGATAATGTAAAAAGTGAGTAAAAA
TTTGAGTTTTTTAAAGATATAATGAGAGTATCTTGTGAAGAATCTGAACATTTTATTCTT
TTATCAGACAGACTAAGTCAAGATAACATAATTTATGGCGATATTCCTGTCCATACAGGT
CTGATTGATAATGTTAAAAATTCAATTAACTGCCCTCTTACAAGAATAGCTCTAATTTCT
ATTGTATAAGAAGGTAAAGGTGTAGATTCAGGGGATAGACTTTTAGTTAAATTAATTTCA
TTCTAAGATAAAATAGGAGCTAAAATATTACAAAGAATTTTAGATGAAGAAGTTGGCCAT
ATAGGTATTGGAAATAAATGGTTTTAGATCATTTGCAAAAATTAAAATATAGACCCTATT
ATAAAATTTAAAGAAATATGCTAAAATCATGGAGTTAAATTCTTTAAGCCTTATAATAAA
GAAGCTAGAATTAAAGCTGGTTATGATGAAAATTGGATATAAAAAATTTGGGAAGAAAAT
TGA