Identifiers and Description

Gene Model Identifier

TTHERM_00023980

Standard Name

RAN1 (RAN GTPase)

Aliases

PreTt12011 | 1.m01059 | Tt-ran

Description

Putative Ran GTPase; an evolutionarily conserved small GTPase with roles in nuclear transport, mitotic spindle assembly and nuclear envelope assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00023980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13865.12.0007442334946695e-153Ras family protein (241 aa)
OxytrichaContig21120.0.g733.001222955304439e-106Ras family
SGDYOR185C7.003003394656772e-98GSP2 GTP binding protein (mamm
alian Ranp homolog) involved i
n the maintenance of nuclear o
rganization, RNA processing an
d transport; interacts with Ka
p121p, Kap123p and Pdr6p (kary
ophilin betas); Gsp1p homolog
that is not required for viabi
lity
WormBaseWBGene000043029.003233894748109e-95locus:ran-1 GTP-binding nucl
ear protein ran-1 status:Con
firmed UniProt:O17915 prot
ein_id:CAB07240.1
DictyBaseDDB_G02912359.998285701479858e-93ranA on chromosome: 6 position
78789 to 80092
Stentor CoeruleusSteCoe_377365.0345753587649823e-45

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22594798: Liang H, Xu J, Zhao D, Tian H, Yang X, Liang A, Wang W (2012) Subcellular localization and role of Ran1 in Tetrahymena thermophila amitotic macronucleus. The FEBS journal 279(14):2520-33
  2. Ref:12787777: Quimby BB and Dasso M (2003) The small GTPase Ran: interpreting the signs. Curr Opin Cell Biol 15(3):338-44
  3. Ref:8026746: Nagata K, Takemasa T, Alam S, Hattori T, Watanabe Y, Nozawa Y (1994) Cloning of cDNAs encoding a cell-cycle-regulatory GTP-binding low-M(r) (GBLM) protein, Ran/TC4, from micronucleated Tetrahymena thermophila and amicronucleated Tetrahymena pyriformis. Gene 144(1):123-5

Sequences

>TTHERM_00023980(coding)
ATGGTTGATAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGATGGT
GGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGATAT
ATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCCATC
AGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGTTAC
TACATTGGTGCCAACGCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAA
AATATTCCTAAGTGGCACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTG
GTCGGTAACAAGGTTGACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCAC
AGAAAGAGATCCCTCTAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAG
CCCTTCCTCTGGATCCTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGT
ATCGCTCTTGTTGCTCCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTG
GAAATGGAACAAGCTGAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAA
GATGATGAATTCAACTGA


>TTHERM_00023980(protein)
MVDNKQNVVAEFKLVLVGDGGVGKTTFVTRHQTGEFEKRYIATQGVNVSNMVLYTTKGPI
RFNIWDTAGQEKLGGLREGYYIGANAAIMMFDVTSRITYKNIPKWHKDLTRICENIPIVL
VGNKVDSKDRKVKARQITFHRKRSLQYYDVSAKSNYQYEKPFLWILRKLTGDPTLNLVEG
IALVAPDTEHVMTEDQIKQLEMEQAEAMNLAQQGVLPDDEDDEFN


>TTHERM_00023980(gene)
ATGGTTGATGTAAATAGTATTTTTTATTCTTTCTTTCTGGCTCAGGAACTGATCTTCAGT
TTTCTTGGATGATGGACACATAGTCTATGAACCTATCATGATTGTTTGTTGATCTCTTTC
CTAAGCCAGAGAGGATTGATTGTTTGCTAATACCTTATTGCTAAACTAACTTTTACAATT
TTAAAATAATAGAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGAT
GGTGGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGA
TATATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCC
ATCAGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGT
TACTAGTAATAATTTTTTTCAAACACTTATCATAAAATTTTTATCATTTGGACTAATTGA
TTGACTGACTGACTGATTAACAAGTTTGTTTGCTGAATAATTGCTTACAAGTCTAACTAG
CTCTTACTATAAATATTCCTTTAGGCTCTGTGTTTGTTCATAACATATAAATAGGAATGT
GAGTCATTCTTTCTTTCTATCTATTTTGTTTATGTTATCAAGCTACAAAGCAAGAGTTGA
TTGCTAAAAATAAGCAACAAGAAATAGAAAGATGATTATTAAATGGTATAAAAGGAATAG
CAGAGACCATCTACATTGATTAAGCCATAGCTTCTTACATTATAAGAAATTATAAAGAAA
GTAGGATGCATTTAGAGAAGATTTAGCTAGCGAAAACCCAATCTTTTGTGGTGATTTATT
TAGCGACGCAATTTAATTTAAAAAGAAAATTTAAAAACAAACTCAGTCTGTCAATCAGTC
AATCAATCAGTCAGTCAGTTCTTTGTTCGTTGAGACTCTTTTTTCATTTAAAAATGCTTA
AATCAATCTATTTAACGAATTTCTAATGAATTTATTTTTAACAATAGCATTGGTGCCAAC
GCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAAAATATTCCTAAGTGG
CACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTGGTCGGTAACAAGGTT
GACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCACAGAAAGAGATCCCTC
TAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAGCCCTTCCTCTGGATC
CTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGTATCGCTCTTGTTGCT
CCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTGGAAATGGAACAAGCT
GAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAAGATGATGAATTCAAC
TGA