Identifiers and Description

Gene Model Identifier

TTHERM_00023980

Standard Name

RAN1 (RAN GTPase)

Aliases

PreTt12011 | 1.m01059 | Tt-ran

Description

RAN1 GTP-binding nuclear protein Ran-1; Putative Ran GTPase; an evolutionarily conserved small GTPase with roles in nuclear transport- mitotic spindle assembly and nuclear envelope assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.9%

TetraMine Data

TTHERM_00023980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13865.12.0007442334946695e-153Ras family protein (241 aa)
OxytrichaContig21120.0.g733.001222955304439e-106Ras family
SGDYOR185C7.003003394656772e-98GSP2 GTP binding protein (mamm
alian Ranp homolog) involved i
n the maintenance of nuclear o
rganization, RNA processing an
d transport; interacts with Ka
p121p, Kap123p and Pdr6p (kary
ophilin betas); Gsp1p homolog
that is not required for viabi
lity
WormBaseWBGene000043029.003233894748109e-95locus:ran-1 GTP-binding nucl
ear protein ran-1 status:Con
firmed UniProt:O17915 prot
ein_id:CAB07240.1
DictyBaseDDB_G02912359.998285701479858e-93ranA on chromosome: 6 position
78789 to 80092
Stentor CoeruleusSteCoe_377365.0345753587649823e-45

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22594798: Liang H, Xu J, Zhao D, Tian H, Yang X, Liang A, Wang W (2012) Subcellular localization and role of Ran1 in Tetrahymena thermophila amitotic macronucleus. The FEBS journal 279(14):2520-33
  2. Ref:12787777: Quimby BB and Dasso M (2003) The small GTPase Ran: interpreting the signs. Curr Opin Cell Biol 15(3):338-44
  3. Ref:8026746: Nagata K, Takemasa T, Alam S, Hattori T, Watanabe Y, Nozawa Y (1994) Cloning of cDNAs encoding a cell-cycle-regulatory GTP-binding low-M(r) (GBLM) protein, Ran/TC4, from micronucleated Tetrahymena thermophila and amicronucleated Tetrahymena pyriformis. Gene 144(1):123-5

Sequences

>TTHERM_00023980(coding)
ATGGTTGATAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGATGGT
GGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGATAT
ATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCCATC
AGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGTTAC
TACATTGGTGCCAACGCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAA
AATATTCCTAAGTGGCACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTG
GTCGGTAACAAGGTTGACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCAC
AGAAAGAGATCCCTCTAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAG
CCCTTCCTCTGGATCCTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGT
ATCGCTCTTGTTGCTCCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTG
GAAATGGAACAAGCTGAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAA
GATGATGAATTCAACTGA


>TTHERM_00023980(protein)
MVDNKQNVVAEFKLVLVGDGGVGKTTFVTRHQTGEFEKRYIATQGVNVSNMVLYTTKGPI
RFNIWDTAGQEKLGGLREGYYIGANAAIMMFDVTSRITYKNIPKWHKDLTRICENIPIVL
VGNKVDSKDRKVKARQITFHRKRSLQYYDVSAKSNYQYEKPFLWILRKLTGDPTLNLVEG
IALVAPDTEHVMTEDQIKQLEMEQAEAMNLAQQGVLPDDEDDEFN


>TTHERM_00023980(gene)
ATGGTTGATGTAAATAGTATTTTTTATTCTTTCTTTCTGGCTCAGGAACTGATCTTCAGT
TTTCTTGGATGATGGACACATAGTCTATGAACCTATCATGATTGTTTGTTGATCTCTTTC
CTAAGCCAGAGAGGATTGATTGTTTGCTAATACCTTATTGCTAAACTAACTTTTACAATT
TTAAAATAATAGAACAAGTAAAACGTTGTTGCTGAATTCAAGCTCGTCTTAGTTGGTGAT
GGTGGTGTCGGTAAGACTACTTTCGTCACTAGACATCAAACTGGTGAATTCGAAAAGAGA
TATATTGCCACCCAAGGTGTCAATGTTTCCAACATGGTCTTATACACCACTAAGGGTCCC
ATCAGATTCAACATTTGGGATACTGCTGGTTAAGAAAAGCTCGGTGGTCTCCGTGAAGGT
TACTAGTAATAATTTTTTTCAAACACTTATCATAAAATTTTTATCATTTGGACTAATTGA
TTGACTGACTGACTGATTAACAAGTTTGTTTGCTGAATAATTGCTTACAAGTCTAACTAG
CTCTTACTATAAATATTCCTTTAGGCTCTGTGTTTGTTCATAACATATAAATAGGAATGT
GAGTCATTCTTTCTTTCTATCTATTTTGTTTATGTTATCAAGCTACAAAGCAAGAGTTGA
TTGCTAAAAATAAGCAACAAGAAATAGAAAGATGATTATTAAATGGTATAAAAGGAATAG
CAGAGACCATCTACATTGATTAAGCCATAGCTTCTTACATTATAAGAAATTATAAAGAAA
GTAGGATGCATTTAGAGAAGATTTAGCTAGCGAAAACCCAATCTTTTGTGGTGATTTATT
TAGCGACGCAATTTAATTTAAAAAGAAAATTTAAAAACAAACTCAGTCTGTCAATCAGTC
AATCAATCAGTCAGTCAGTTCTTTGTTCGTTGAGACTCTTTTTTCATTTAAAAATGCTTA
AATCAATCTATTTAACGAATTTCTAATGAATTTATTTTTAACAATAGCATTGGTGCCAAC
GCCGCTATCATGATGTTCGATGTCACCTCCAGAATTACTTATAAAAATATTCCTAAGTGG
CACAAGGATTTGACCAGAATCTGCGAAAATATTCCCATCGTTTTGGTCGGTAACAAGGTT
GACTCTAAGGACAGAAAGGTCAAGGCTAGACAAATCACTTTCCACAGAAAGAGATCCCTC
TAATATTATGATGTCTCTGCTAAATCTAACTATTAATACGAAAAGCCCTTCCTCTGGATC
CTCAGAAAGCTCACCGGTGATCCCACCCTTAACCTCGTCGAAGGTATCGCTCTTGTTGCT
CCTGATACTGAACACGTCATGACTGAAGATCAAATCAAGCAATTGGAAATGGAACAAGCT
GAAGCTATGAACCTCGCCCAACAAGGTGTCCTTCCTGATGATGAAGATGATGAATTCAAC
TGA