Identifiers and Description

Gene Model Identifier

TTHERM_00298220

Standard Name

RAD5L4 (RADiation sensitive protein family 5-like 4)

Aliases

PreTt19224 | 28.m00183 | 3691.m00002

Description

SNF2 family amine-terminal protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06519 ) TolA protein
  • ( PF07549 ) SecD/SecF GG Motif
  • ( PF02349 ) Major surface glycoprotein
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00298220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07549.19.997093137033517e-262hypothetical protein (646 aa)
SGDYLR032W4.0007753645635287e-88RAD5 DNA helicase proposed to
promote replication fork regre
ssion during postreplication r
epair by template switching; R
ING finger containing ubiquiti
n ligase; stimulates the synth
esis of free and PCNA-bound po
lyubiquitin chains by Ubc13p-M
ms2p
DictyBaseDDB_G02821155.002382393859839e-46DDB_G0282115 on chromosome: 3
position 5399711 to 5404710
Stentor CoeruleusSteCoe_196837.47197233734299e-43
WormBaseWBGene000100611.0004783691736523e-35status:Partially_confirmed U
niProt:G5EEW5 protein_id:CAB
05213.1
OxytrichaContig12570.0.g361.0000422327488734e-24SNF2 family N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00298220(coding)
ATGGATAGATTTCTACCATTGACTATTAGCAAAACATACAATATCGATTAGGCTGTTGTT
GAGAAGATTATCAAAGAAAAGGAATTGAAAAGTAGATAAGAAATAATGAATTTTTTTGCA
CTTAACAAGGATAAAATACAGACTTTGTTTTAGGACAACCAAATAGAATCTATAATAAAT
GAGGAATTTATGGATACTTAGAATATTGTATTAAAATAAATTCCAAATTTGATAGTGAGC
AAATACTAAAAAGCTAACTAGGATATTATTTAATCTTACTGTAATTTAATGAGGGAGCTA
TTTCCAAAACAACAAGATTTATTCAATGACATATCGTAAAATTAGCTTATTTGGCCAAAA
TACATAGGATCTCTTTTGATTCCTGTAGAAGTGTCTGACTTACCTTCAAATTTATAAGCC
AATTAAGAACTTTGCATTAACTTTGGAGCTTTCGAGTTAGACACAAAAGAAGTATAATAT
GCTAAGAAAAAATATATTTTTAACGTTAATATTGAGAGTCTTTACATCTTAATTTATACT
AAAAGAAAAGAATATCTAGGAAAGATTGATCATAGATTCTTTTTTATATGGAATATACTT
AATACAATTCAGTTTGCTAATTTTAGATTATTTGTCCATAAAATAGAATCTAAAAATTGT
TTACAAATCAGATTTGATGTTTTTGTTACTGAAAAAATATGTTCTTTGTATGCTGAGCAC
AAAGAAGAAGATAAGAATGTTTTCAATAAAGAAACTTTAAAAGAGATGAGTATGGAAGAT
TAAAAAAAATTAGTGATGAGAAAATATGCAAGCGAATCAATTAAAGTTATGAAAGCATTT
TTATATGTGAAAGAAACTATTCCAGCCATACTTACACCAATAGAAAGAAGTTTAGATTTA
TTAGGTGGCATTTAATATCGTATGCAATAGAGACAGTCATAAGGACCTCTTTTCTCATTC
ATTCCTTCCAAACTAGTTATAAAACCAGGATTATTAGGTTATTATTCAGATTAGGCTCAA
TAAGCTTAAAACTAAAATTAATAACAGAATGAATAACAAAAAATTATAACCATGCTTAAT
TAAGCTGAAAAGGCTGGGTAAGATAATTTCCTAAAAGATATGAAAGAGAGAGACTTAGAA
ATTTAATAAATAAATTAAATAGAAGAAGAATTTAAGATTAATGAAAGCGAAATCATTAAA
AATAAGAATGATTAGAATGCACAAAATTAAAAATAAAAAGTTGACATATAAAACGGAGCT
ACAAATAAATGCAAAGACCCTAAAAAAGCAAAGTTTAAAAATGGTAAACAAAGCGATTAA
GTAAATAAGGAAAATAAAATGATGCCTACTGAAGAATAAGAAATATAAAATAGCAGCAGT
AATATTAGTAGCGAAGAGAATGATAACATTGAAGAAGAAAATGATAATGAGGATGATGAA
GATGATGAAAAGGATAACTAGATAGATTAAGAAAATTGTGAAAATAATTTTGATGTATTT
GAAGGCGAGGAATTTTTAAGAAATTTAGATCCAAACTATGATAATAATTAAGAAAATTTA
TGGTAAGAAATTCCTGATGGCATAAACAGAGTTAGCTCTTCTACTTCAAGTACAACACTA
AATAGTGATATTGGAAGTCTTTTAGGAGTTAATGATTAGTAGATAACAGATTATTTTAAC
TTGCAAAATCCACCTAGTTTATTCTAGACATCTCTTTTTGAATATTAATAGCAAGCTTTG
ACTTGGATGCTTTACAAAGAAAAAGCACTCACTTTTGAAGAAGCAGCTAGGCCTGAAATT
TAAGAAAGGCCAAGATAATTAAATGAATTTTGGTGTGAACTCTTATTTCTTGATGGGTCT
CTCATGTACTTTAATGAATATTCTTAGTCATTTTCACACCGTTTTTAAAAAAGTGAGGCT
AATTTGTAAAATGGAGGTATCTTAGCAGATGAAATGGGTTTAGGTAAAACAGTTATGGCA
TTAAGTCTGATTGCGTCTAATCTACCTAAAATAGATCACAAAAGTAATCCTCTAATAATA
GGCATAAATGATCAAGTTAAAAAGAAAGTCAAAAAAAACAAAAATCAAAAAGAAGCTTAA
GATATGGTTGAAGCTTTTGAGTAAAAAAAAAAATAAGGTTTGATTCGAGCTGGAACTTTA
ATTATTCTTCCCTTATCAGTTTTAACTTAATGGTGTAACGAAGTTAATCGCCACTTTAAA
AAATCTTCTCTGTTTTATTTTGAATACTACGATTCTAAAAGTAGATCAAGTCCCATTCTC
CATCTATATGATATAGTTTTTACAACATATAATATTCTAGGAATGGAGTATAAAAATTAC
TTTATTGCAGGAGCTCCTCAAAAAACAAACCTATTTAATTATTATTGGCACAGAATTATA
CTTGATGAAGCTCATACAATAAAAGGCAAAGGAAATAACTGCTCAAAAGGTGCTTACAAT
TTACAAGCAGAAAATAGATGGTGTATGACAGGTACACCCATTCATAACTGTTTTGATGAT
TTATATAGTCTGATATATTTTTTGAAATATGACACATTTTAAGACTACTATTGGTGGAAT
AAACATATAAATAATTGTGAAAATAAAGAAGAAGTATTTAAGTTACTATAAAATATCTTA
AGACCTATACTTCTGCGTCGTACTAAAAAATCAAAGTATAATGATGGAAGTAGTATAATC
AAAATTCCTAAAAAAACATAAAAAATACTGCTTATCCCTTTTAAAAAAGCAGAAAGATAA
ATATATGATACGCTTCAGCGTCAGTCTTAAAAAGTTTTAAAAAATATTCTTATTGATAAA
AATTAATTTTCATCAAACTATCTTCATATATTTTCAATAATGACAAAACTAAGATAAATG
TGTGACCATTCTATGCTTATGCTAAATAAAATACCTATGATTAAGATAAAATAGTAAATA
GATACTTTAGAATAGTAAATAGCAAAAAATGAATCAACCTCAATTACAGAAATGTAAGCA
TATAATATCTTTATTAGCAAAATTGTTGATAATATAATGAATGATAATGATATCTATTAG
TTCAATGCCAATAACTAATAAAGGTAACAGCAATAGTAAAATAACTATATCTAATAAAGA
TAGCAGAATATTTAATTTAAAGCATAAGTTCAATAAAGTCTCATAAAAAAAGATTTAACA
GAGTGTTTTTGTACAGAGCCTTATGAATAAGAAGTAGCTTTACTTTAATGTGGCCATTTC
TTTCATATGAATTGTATATAAGAAATGTTCAGAGTACAATAAAATTAAAACATAGTACCT
AATTGTCCCATGTGTAGAGTGCCATTTGAGGAGAATCAAATAAACAAAATTAACTTTTAA
CAAATAAAAGAAGAATCTAAGGAGTTAGAAGCTAAGATAAAACAACAAGTTATTCAATAA
GTCAAAGATAAAAAAGAAAAGCTGAAAATTTTGAAAGTTTTATCTCCTGATAATAGTAGT
AAGCTTTAGATTATTGTGAAAGAAGTAAAAAAGGTTTAATAAATGAAAGAAAAAGTTATA
ATTTATTCATAATTTTTAAGCTTTTTGACTTACTTACAAAAAGTTCTAAATGATAGAGAT
GTGAGATATACACGTCTTGATGGGACTATGAATAAAAAGGATAGAGCTACTGCAATCAAA
ACATTCAGTGAATAGTCTGAATTTACAGCAATTTTGATATCTTTGAAAGCTGGTGCATTT
GGTCTAAACCTAGTTGCTGCCAATCACGTATTCATATGTGATCCTTGGTATAATCCAGCT
ATAGAAGAATAAGCAATTGAAAGGTGTCATAGAATAGGATAAACTAAGAGAGTTCAAGTC
ATTAATTTCATAATGGAGTCTTCAATTGAGGAAAGGATTCTTTAGTGTTAAAAAAAGAAA
AGAAGCTTAATTTAAAATACTCTTTATATTTAAAAAAATAACTTAAGTGAGTTAGAGAAA
GAACAAGAAATTCAAGCTAAGATGAAAGAAATAAGATATATTATTGGTTTTGATGAAGAT
GAAAACTAAGAGGAAAAAAATATGACTAAAATGGATGAAGAAGAAAATATCAAAGAAATA
AAAAATTAAATGTATGACGATTTTGATGATGGTGAGGAAACTATTGTCAAAGAAATAGAT
GTATGA


>TTHERM_00298220(protein)
MDRFLPLTISKTYNIDQAVVEKIIKEKELKSRQEIMNFFALNKDKIQTLFQDNQIESIIN
EEFMDTQNIVLKQIPNLIVSKYQKANQDIIQSYCNLMRELFPKQQDLFNDISQNQLIWPK
YIGSLLIPVEVSDLPSNLQANQELCINFGAFELDTKEVQYAKKKYIFNVNIESLYILIYT
KRKEYLGKIDHRFFFIWNILNTIQFANFRLFVHKIESKNCLQIRFDVFVTEKICSLYAEH
KEEDKNVFNKETLKEMSMEDQKKLVMRKYASESIKVMKAFLYVKETIPAILTPIERSLDL
LGGIQYRMQQRQSQGPLFSFIPSKLVIKPGLLGYYSDQAQQAQNQNQQQNEQQKIITMLN
QAEKAGQDNFLKDMKERDLEIQQINQIEEEFKINESEIIKNKNDQNAQNQKQKVDIQNGA
TNKCKDPKKAKFKNGKQSDQVNKENKMMPTEEQEIQNSSSNISSEENDNIEEENDNEDDE
DDEKDNQIDQENCENNFDVFEGEEFLRNLDPNYDNNQENLWQEIPDGINRVSSSTSSTTL
NSDIGSLLGVNDQQITDYFNLQNPPSLFQTSLFEYQQQALTWMLYKEKALTFEEAARPEI
QERPRQLNEFWCELLFLDGSLMYFNEYSQSFSHRFQKSEANLQNGGILADEMGLGKTVMA
LSLIASNLPKIDHKSNPLIIGINDQVKKKVKKNKNQKEAQDMVEAFEQKKKQGLIRAGTL
IILPLSVLTQWCNEVNRHFKKSSLFYFEYYDSKSRSSPILHLYDIVFTTYNILGMEYKNY
FIAGAPQKTNLFNYYWHRIILDEAHTIKGKGNNCSKGAYNLQAENRWCMTGTPIHNCFDD
LYSLIYFLKYDTFQDYYWWNKHINNCENKEEVFKLLQNILRPILLRRTKKSKYNDGSSII
KIPKKTQKILLIPFKKAERQIYDTLQRQSQKVLKNILIDKNQFSSNYLHIFSIMTKLRQM
CDHSMLMLNKIPMIKIKQQIDTLEQQIAKNESTSITEMQAYNIFISKIVDNIMNDNDIYQ
FNANNQQRQQQQQNNYIQQRQQNIQFKAQVQQSLIKKDLTECFCTEPYEQEVALLQCGHF
FHMNCIQEMFRVQQNQNIVPNCPMCRVPFEENQINKINFQQIKEESKELEAKIKQQVIQQ
VKDKKEKLKILKVLSPDNSSKLQIIVKEVKKVQQMKEKVIIYSQFLSFLTYLQKVLNDRD
VRYTRLDGTMNKKDRATAIKTFSEQSEFTAILISLKAGAFGLNLVAANHVFICDPWYNPA
IEEQAIERCHRIGQTKRVQVINFIMESSIEERILQCQKKKRSLIQNTLYIQKNNLSELEK
EQEIQAKMKEIRYIIGFDEDENQEEKNMTKMDEEENIKEIKNQMYDDFDDGEETIVKEID
V


>TTHERM_00298220(gene)
ATGGATAGATTTCTACCATTGACTGTAACGCTCATCTATGAAAAATAAAATATCCAACTT
TTATTTTATTCAATTTTTTAAATAGATTAGCAAAACATACAATATCGATTAGGCTGTTGT
TGAGAAGATTATCAAAGAAAAGGAATTGAAAAGTAGATAAGAAATAATGAATTTTTTTGC
ACTTAACAAGGATAAAATACAGACTTTGTTTTAGGACAACCAAATAGAATCTATAATAAA
TGAGGAATTTATGGATACTTAGAATATTGTATTAAAATAAATTCCAAATTTGATAGTGAG
CAAATACTAAAAAGCTAACTAGGATATTATTTAATCTTACTGTAATTTAATGAGGGAGCT
ATTTCCAAAACAACAAGATTTATTCAATGACATATCGTAAAATTAGCTTATTTGGCCAAA
ATACATAGGATCTCTTTTGATTCCTGTAGAAGTGTCTGACTTACCTTCAAATTTATAAGC
CAATTAAGAACTTTGCATTAACTTTGGAGCTTTCGAGTTAGACACAAAAGAAGTATAATA
TGCTAAGAAAAAATATATTTTTAACGTTAATATTGAGAGTCTTTACATCTTAATTTATAC
TAAAAGAAAAGAATATGTAAACATTTTAAAATATTTTTATTGAAATAATTTAAAGAATTA
CAAAATGTTTTAAATTAATAATTATTATTTCAATTAATATAGCTAGGAAAGATTGATCAT
AGATTCTTTTTTATATGGAATATACTTAATACAATTCAGTTTGCTAATTTTAGATTATTT
GTCCATAAAATAGAATCTAAAAATTGTTTACAAATCAGATTTGATGTAAAAAATCAATTT
ACTATTTTATTTAATTTTATTTTTAATTGATGTTATATTCAGGTTTTTGTTACTGAAAAA
ATATGTTCTTTGTATGCTGAGCACAAAGAAGAAGATAAGAATGTTTTCAATAAAGAAACT
TTAAAAGAGATGAGTATGGAAGATTAAAAAAAATTAGTGATGAGAAAATATGCAAGCGAA
TCAATTAAAGTTATGAAAGCATTTTTATATGTGAAAGAAACTATTCCAGCCATACTTACA
CCAATAGAAAGAAGTTTAGATTTATTAGGTGGCATTTAATATCGTATGCAATAGAGACAG
TCATAAGTAAATCCTCACAAAATAAAAAAAAAATATTTTTGAATATTTTATTTATTTAAA
TAAAGGGACCTCTTTTCTCATTCATTCCTTCCAAACTAGTTATAAAACCAGGATTATTAG
GTTATTATTCAGATTAGGCTCAATAAGCTTAAAACTAAAATTAATAACAGAATGAATAAC
AAAAAATTATAACCATGCTTAATTAAGCTGAAAAGGCTGGGTAAGATAATTTCCTAAAAG
ATATGAAAGAGAGAGACTTAGAAATTTAATAAATAAATTAAATAGAAGAAGAATTTAAGA
TTAATGAAAGCGAAATCATTAAAAATAAGAATGATTAGAATGCACAAAATTAAAAATAAA
AAGTTGACATATAAAACGGAGCTACAAATAAATGCAAAGACCCTAAAAAAGCAAAGTTTA
AAAATGGTAAACAAAGCGATTAAGTAAATAAGGAAAATAAAATGATGCCTACTGAAGAAT
AAGAAATATAAAATAGCAGCAGTAATATTAGTAGCGAAGAGAATGATAACATTGAAGAAG
AAAATGATAATGAGGATGATGAAGATGATGAAAAGGATAACTAGATAGATTAAGAAAATT
GTGAAAATAATTTTGATGTATTTGAAGGCGAGGAATTTTTAAGAAATTTAGATCCAAACT
ATGATAATAATTAAGAAAATTTATGGTAAGAAATTCCTGATGGCATAAACAGAGTTAGCT
CTTCTACTTCAAGTACAACACTAAATAGTGATATTGGAAGTCTTTTAGGAGTTAATGATT
AGTAGATAACAGATTATTTTAACTTGCAAAATCCACCTAGTTTATTCTAGACATCTCTTT
TTGAATATTAATAGCAAGCTTTGACTTGGATGCTTTACAAAGAAAAAGCACTCACTTTTG
AAGAAGCAGCTAGGCCTGAAATTTAAGAAAGGCCAAGATAATTAAATGAATTTTGGTGTG
AACTCTTATTTCTTGATGGGTCTCTCATGTACTTTAATGAATATTCTTAGTCATTTTCAC
ACCGTTTTTAAAAAAGTGAGGCTAATTTGTAAAATGGAGGTATCTTAGCAGATGAAATGG
GTTTAGGTAAAACAGTTATGGCATTAAGTCTGATTGCGTCTAATCTACCTAAAATAGATC
ACAAAAGTAATCCTCTAATAATAGGCATAAATGATCAAGTTAAAAAGAAAGTCAAAAAAA
ACAAAAATCAAAAAGAAGCTTAAGATATGGTTGAAGCTTTTGAGTAAAAAAAAAAATAAG
GTTTGATTCGAGCTGGAACTTTAATTATTCTTCCCTTATCAGTTTTAACTTAATGGTGTA
ACGAAGTTAATCGCCACTTTAAAAAATCTTCTCTGTTTTATTTTGAATACTACGATTCTA
AAAGTAGATCAAGTCCCATTCTCCATCTATATGATATAGTTTTTACAACATATAATATTC
TAGGAATGGAGTATAAAAATTACTTTATTGCAGGAGCTCCTCAAAAAACAAACCTATTTA
ATTATTATTGGCACAGAATTATACTTGATGAAGTAATTTTATTCTAAATTTAAATTAAAA
TATAAAAAATGTTTATTTTAAATACAGTAAAAATATCTTTTCAAAATAAAAATTTTAATG
ATTCAAATTTTTAACAAGTTTTGAAAATTTTTCTGAAATTAATTTTGAAATTTTTAAATT
TTATTAAATAAAAAATTTTAATTTTAAAAATTATTTAATTAAACTCTGAATATATTTGTG
GATTTAATAAAAATTTAAACTCATATAAAATTTTAAAATAAAGGCTCATACAATAAAAGG
CAAAGGAAATAACTGCTCAAAAGGTGCTTACAATTTACAAGCAGAAAATAGATGGTGTAT
GACAGGTACACCCATTCATAACTGTTTTGATGATTTATATAGTCTGATATATTTTTTGAA
ATATGACACATTTTAAGACTACTATTGGTGGAATAAACATATAAATAATTGTGAAAATAA
AGAAGAAGTATTTAAGTTACTATAAAATATCTTAAGACCTATACTTCTGCGTCGTACTAA
AAAATCAAAGTATAATGATGGAAGTAGTATAATCAAAATTCCTAAAAAAACATAAAAAAT
ACTGCTTATCCCTTTTAAAAAAGCAGAAAGATAAATATATGATACGCTTCAGCGTCAGTC
TTAAAAAGTTTTAAAAAATATTCTTATTGATAAAAATTAATTTTCATCAAACTATCTTCA
TATATTTTCAATAATGACAAAACTAAGATAAATGTGTGACCATTCTATGCTTATGCTAAA
TAAAATACCTATGATTAAGATAAAATAGTAAATAGATACTTTAGAATAGTAAATAGCAAA
AAATGAATCAACCTCAATTACAGAAATGTAAGCATATAATATCTTTATTAGCAAAATTGT
TGATAATATAATGAATGATAATGATATCTATTAGTTCAATGCCAATAACTAATAAAGGTA
ACAGCAATAGTAAAATAACTATATCTAATAAAGATAGCAGAATATTTAATTTAAAGCATA
AGTTCAATAAAGTCTCATAAAAAAAGATTTAACAGAGTGTTTTTGTACAGAGCCTTATGA
ATAAGAAGTAGCTTTACTTTAATGTGGCCATTTCTTTCATATGAATTGTATATAAGAAAT
GTTCAGAGTACAATAAAATTAAAACATAGTACCTAATTGTCCCATGTGTAGAGTGCCATT
TGAGGAGAATCAAATAAACAAAATTAACTTGTAATTAATTAGATAAATATTTTATTTAAT
ATATTTATCTTATCTAACTCAAGTAAAAAAATACTTTTTTTATAAATAGTTAACAAATAA
AAGAAGAATCTAAGGAGTTAGAAGCTAAGATAAAACAACAAGTTATTCAATAAGTCAAAG
ATAAAAAAGAAAAGCTGAAAATTTTGAAAGTTTTATCTCCTGATAATAGTAGTAAGCTTT
AGATTATTGTGAAAGAAGTAAAAAAGGTTTAATAAATGAAAGAAAAAGTTATAATTTATT
CATAATTTTTAAGCTTTTTGACTTACTTACAAAAAGTTCTAAATGATAGAGATGTGAGAT
ATACAGTAAATTAAATTAAATTATTTTTAATTTAGTTTCTTTTAACTTAAATTTTTTTGA
TAAAAAAAAAAGCGTCTTGATGGGACTATGAATAAAAAGGATAGAGCTACTGCAATCAAA
ACATTCAGTGAATAGTCTGAATTTACAGCAATTTTGATATCTTTGAAAGCTGGTGCATTT
GGTCTAAACCTAGTTGCTGCCAATCACGTATTCATATGTGATCCTTGGTATAATCCAGCT
ATAGAAGTATTTTTATCTGCAAATAATATTATTAGTAATTATAATTTTATTAAAATTAAA
TAAGGAATAAGCAATTGAAAGGTGTCATAGAATAGGATAAACTAAGAGAGTTCAAGTCAT
TAATTTCATAATGGAGTCTTCAATTGAGGAAAGGATTCTTTAGTGTTAAAAAAAGAAAAG
AAGCTTAATTTAAAATACTCTTTATATTTAAAAAAATAACTTAAGTGAGTTAGAGAAAGA
ACAAGAAATTCAAGCTAAGATGAAAGAAATAAGATATATTATTGGTTTTGATGAAGATGA
AAACTAAGAGGAAAAAAATATGACTAAAATGGATGAAGAAGAAAATATCAAAGAAATAAA
AAATTAAATGTATGACGATTTTGATGATGGTGAGGAAACTATTGTCAAAGAAATAGATGT
ATGA