Identifiers and Description

Gene Model Identifier

TTHERM_00237490

Standard Name

RAD54 (Homolog of budding yeast RAD54)

Aliases

PreTt18793 | 20.m00257 | 3706.m00024

Description

SNF2 family N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00237490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07944.19.997093137033517e-262SNF2 family domain-containing
protein (1016 aa)
DictyBaseDDB_G02829973.0008389609965914e-128rad54 on chromosome: 4 positio
n 118731 to 121607
WormBaseWBGene000042986.001241942754875e-123locus:rad-54 status:Partiall
y_confirmed UniProt:G5EEN6
protein_id:CAA22254.2
SGDYGL163C1.999447289884935e-116RAD54 DNA-dependent ATPase, st
imulates strand exchange by mo
difying the topology of double
-stranded DNA; involved in the
recombinational repair of dou
ble-strand breaks in DNA durin
g vegetative growth and meiosi
s; member of the SWI/SNF famil
y
Stentor CoeruleusSteCoe_194393.917469664450395e-64
OxytrichaContig12570.0.g361.9999167998962255e-60SNF2 family N-terminal domain

General Information

Paragraph NoGene NameParagraph Text
53RAD54In yeast, DNA-dependent ATPase that stimulates strand exchange; modifies the topology of double-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00237490(coding)
ATGTTAAAAAAACCATTCAAACCTCCTGGATCTAAAGATGGTTCAGAAAATACAAGCGGT
TTATCAAAACCATTTTAAAAGCCATTGCTGAAATAAACTATTTCTGCTCCTTCTAACTTA
GAGTCAGCAAAAGCTACTAAGAAAGAAGAGTCAGTTGACTCAAAAGAATAGCCTATTAGT
GATTCAGAAAATTTAAAAGAAAACAAAGAAAAAACTACTCCTGTAATTTAAAATAAACCA
TAGGGCTTATTAGGATTGAAGTCAAAGCCATTCAAACCTTTAGTAAGTAAGTTAGAAGTT
AAAAGTAATACTGATACTAAAACTTAAATGAAACCTAGCTCAACTTTTAGCACAAATCCT
ACAGCAAAAAATTAACCACCATAATAAGAAGAAAAAAATAGTCCTGAAGAATTTTATAAA
TGCTTTTGGTCGAAAGACGTTAAGAAAAAACACAAAGTATTAGATGATGGTATTATAGTA
TTTACTTCTAGTAAAGTATAAATATATAACTCAGATGGAGAAAAAATTTACGATAGCTAC
AAATCAAAACTGTATTGTCCTAATCCAGATAATGGAAACTAATACATAGTAGGTTAATAT
TTTGTTGAGCAGGATGATAAAATATCAAAAGATGATTTCTTAAGTGGAAGATGCTTTGTC
AAGGCCAAAATGACTTATGAAAAAGATTAAACAATCGCCAAAAAAAAAATAGCCCCAATG
AAGAAAAATACATAGTCTGAAGGGCCTAAACCCTCAGATATAGTTGTTCCTGAAAACTCG
TATTTGCTCACTGACCCTTCTAATAAATAACTTTTTCCTGTTTACATCGATGTTTACTTG
AATAATAGCATGAGAATTCATCAAAGATTGGGTGTTAAATTTATGTTTGAGTGTATTTCA
GGCCTTAGAGGACCTGATATTGGTGGTTGCATTTTAGCTGATAGTATGGGTCTCGGTAAG
ACACTTCAAACAATAGCATTAATCTGGACTTTGATAAGAAGAAATCCACATTCAGGAACT
TCACCTTTAATTAGAAAAGTTGTAGTAGTAGCACCAGTAAGTCTATTAGGAAGTTGGAAT
AAAGAAGTAAAAAAATGGCTAGGAGATGCACGTTTAATCCCTAAAATAGCTTTAGGCAAA
AGAGAAACAGTAATCAGAATTTGCAAAGAATTCGCAAGTAGCTCAGCTAAAATGCTTCTA
ATTTCTTACGAGTAATTTAGAATGCATGTAGAGACTTTATCTAATGCTTGTGACCTCTTA
ATTTTCGATGAAGGTCACAGACTCAAAAACATGAATATCAAAACATTTAGATCTTTTAAT
TCAATTAAATGCAATAGGCGTATTATACTAACTGGTACACCACTTCAGAACTCTTTAGAT
GAATTCTACTCTTGTGTTAAGTTTGTTAACCCGAATATCTTTGAAAACGAAAAGTAGTTT
AAATTTGTTTTTTCAGATCCTATTTTGGCAGCTTTAAAAAGTGATGCTTCTGCAGATGCT
GTCGAAAAGGCTGCTGTAAGAAGTAAAGAACTCACTCATATAATCAGTAGATTCGTTTTA
AGAAGAAAGGCTGATATTTTGGAAAAATTATTACCTCCTCGTTCTGAATACTTTATCTTT
TTGAAGCTTACACCTTTTTAAAACATGTTATATAAGAAGATGATATAAGCAAGATATAAT
AAAAGCGAACTTGATACTGGTGAAGGTGCTTTTGGCCTTCTGACTATAATGAGAAAGTTA
CTCAATCACCCTTAGCTTATATACACTGATGTAGGCAACCAAACGTCTTAAGAGTTTAAG
CAATATTTCCCTTAAGATTATCAACTTGATGATTGGGAAGCTTCTTTTAAGTTTAAATTT
ATTTCAGATTTACTAGATTAAATGAGATAGATTGAAATAGCCTAAAAATCAACTGAAAGA
ATAATTATCGTATCTTATTGGACTTAAACTCTTGATGTTCTATAAATTATGATCAAATAA
AAAAATTTAAAATTTGTCCGTCTTGATGGTTCAGTGAATGCACAAAAAAGATAAGAATTG
ATTGATAGATTCTAAGACCCCACTAATGACATCAAAGTTTTCTTGCTTTGTGGTAGTGCA
GGTGGTACAGGTTTAAATCTTAGTGCAGCAAACAGAATGGTTTTAATGGAAGCTAACTGG
AATCCTTCAAACGATTTATAGGTTATGGGAAGAATTTGGAGAGATGGATAAACAAAACCA
GTGCATATTTACAGATTAGTTGCTTGTGGCACTATGGAAGAAAAAGTTCTACAGAGATAG
TTCTTGAAAGAAGACTTAAGTTAAAATGTAGTTGATGAAAAAATGATTGTTAAACAATAT
AATAATGATAAACTAAAATAACTTTTTGAATTTAAGGGAGATAATTAATGTACCAGCTTT
AAAGAAGATGAAAATTAATTAAATTAATTAAAAGAGTTTACTCCTGATTATGTTGATACT
ATGGAGAAATATATAACTTTTGTAAAGAGAACAATTAAGGGAGAAAAGAAAGATTAGGAG
TAAGAGAGTGAAAATGTAATTGATAATGCTTTTGATGAAGGAAATATTTTCTTAAAACCA
GAAGCCTAAAATGAAGATGAAGCTGATGGAGAAGATTCATTAGATGATAAAGAAATTAAT
GAAGAAGAGGAAGAAAAAATAAGAGAAGAATTAACTAAAGACATCTCTGAATCCACAGCA
GCAACAGGAGAGCTAAGCAGAATAATAGAGGAAGATGATAAAAATGTTAAAGAGTGTAAT
GAGAGTGATGATGATTTTGCTATATTTAATTATGCTAAAAAAAAGGATTCAGATAATGAA
TAACCCATAAAAGAAATAAAGAATGAAGATCTTATAGATAACTAAATTGCAGCTGAAAAG
GAGGAAGAATCATAAAATAAAGATAATAAAGAAGCAGATATGCAAGTTGAAGAAAAAGCT
GAAGATGAAGATGAAGTTGTTGTAACAAAAGGCAGAAGAGGAAGAAGAAAAGCAACTACA
ACAAGTGATACTAATCCAGCCAAAAATATACTTAAAAAATTAAAAAAATGA


>TTHERM_00237490(protein)
MLKKPFKPPGSKDGSENTSGLSKPFQKPLLKQTISAPSNLESAKATKKEESVDSKEQPIS
DSENLKENKEKTTPVIQNKPQGLLGLKSKPFKPLVSKLEVKSNTDTKTQMKPSSTFSTNP
TAKNQPPQQEEKNSPEEFYKCFWSKDVKKKHKVLDDGIIVFTSSKVQIYNSDGEKIYDSY
KSKLYCPNPDNGNQYIVGQYFVEQDDKISKDDFLSGRCFVKAKMTYEKDQTIAKKKIAPM
KKNTQSEGPKPSDIVVPENSYLLTDPSNKQLFPVYIDVYLNNSMRIHQRLGVKFMFECIS
GLRGPDIGGCILADSMGLGKTLQTIALIWTLIRRNPHSGTSPLIRKVVVVAPVSLLGSWN
KEVKKWLGDARLIPKIALGKRETVIRICKEFASSSAKMLLISYEQFRMHVETLSNACDLL
IFDEGHRLKNMNIKTFRSFNSIKCNRRIILTGTPLQNSLDEFYSCVKFVNPNIFENEKQF
KFVFSDPILAALKSDASADAVEKAAVRSKELTHIISRFVLRRKADILEKLLPPRSEYFIF
LKLTPFQNMLYKKMIQARYNKSELDTGEGAFGLLTIMRKLLNHPQLIYTDVGNQTSQEFK
QYFPQDYQLDDWEASFKFKFISDLLDQMRQIEIAQKSTERIIIVSYWTQTLDVLQIMIKQ
KNLKFVRLDGSVNAQKRQELIDRFQDPTNDIKVFLLCGSAGGTGLNLSAANRMVLMEANW
NPSNDLQVMGRIWRDGQTKPVHIYRLVACGTMEEKVLQRQFLKEDLSQNVVDEKMIVKQY
NNDKLKQLFEFKGDNQCTSFKEDENQLNQLKEFTPDYVDTMEKYITFVKRTIKGEKKDQE
QESENVIDNAFDEGNIFLKPEAQNEDEADGEDSLDDKEINEEEEEKIREELTKDISESTA
ATGELSRIIEEDDKNVKECNESDDDFAIFNYAKKKDSDNEQPIKEIKNEDLIDNQIAAEK
EEESQNKDNKEADMQVEEKAEDEDEVVVTKGRRGRRKATTTSDTNPAKNILKKLKK


>TTHERM_00237490(gene)
ATGTTAAAAAAACCATTCAAACCTCCTGGATCTAAAGATGGTTCAGAAAATACAAGCGGT
TTATCAAAACCATTTTAAAAGCCATTGCTGAAATAAACTATTTCTGCTCCTTCTAACTTA
GAGTCAGCAAAAGCTACTAAGAAAGAAGAGTCAGTTGACTCAAAAGAATAGCCTATTAGT
GATTCAGAAAATTTAAAAGAAAACAAAGAAAAAACTACTCCTGTAATTTAAAATAAACCA
TAGGGCTTATTAGGATTGAAGTCAAAGCCATTCAAACCTTTAGTAAGTAAGTTAGAAGTT
AAAAGTAATACTGATACTAAAACTTAAATGAAACCTAGCTCAACTTTTAGCACAAATCCT
ACAGCAAAAAATTAACCACCATAATAAGAAGAAAAAAATAGTCCTGAAGAATTTTATAAA
TGCTTTTGGTCGAAAGACGTTAAGAAAAAACACAAAGTATTAGATGATGGTATTATAGTA
TTTACTTCTAGTAAAGTATAAATATATAACTCAGATGGAGAAAAAATTTACGATAGCTAC
AAATCAAAACTGTATTGTCCTAATCCAGATAATGGAAACTAATACATAGTAGGTTAATAT
TTTGGTAAGCAGAAAGTAATTTAAAGTGATGATTTCAATTGATTTTTTTAATAAAATTTA
GTTGAGCAGGATGATAAAATATCAAAAGATGATTTCTTAAGTGGAAGATGCTTTGTCAAG
GCCAAAATGACTTATGAAAAAGATTAAACAATGTAATTTAGTTTATTTTTAGCTACTCTT
TTGATAAAGATTTCTTACTAAAACTAAAATTTAACTCTTTTTTGTCTAAAATACATTAAA
AGCGCCAAAAAAAAAATAGCCCCAATGAAGAAAAATACATAGTCTGAAGGGCCTAAACCC
TCAGATATAGTTGTTCCTGAAAACTCGTATTTGCTCACTGACCCTTCTAATAAATAACTT
TTTCCTGTTTACATCGATGTTTACTTGAATAATAGCATGAGAATTCATCAAAGATTGGGT
GTTAAATTTATGTTTGAGTGTATTTCAGGCCTTAGAGGACCTGATATTGGTGGTTGCATT
TTAGCTGTAAATTATTAAAATATTATTCAAATAACTAATTAATTGATTTTATAATCAATT
TTAGGATAGTATGGGTCTCGGTAAGACACTTCAAACAATAGCATTAATCTGGACTTTGAT
AAGAAGAAGTAATGCTAAAAATTTATTTTAGGTTATAAATAGTTTATAAAAAAATAATTA
ATTAATTAATAGATCCACATTCAGGAACTTCACCTTTAATTAGAAAAGTTGTAGTAGTAG
CACCAGTAAGTCTATTAGGAAGTTGGAATAAAGAAGTAAAAAAATGGCTAGGAGATGCAC
GTTTAATCCCTAAAATAGCTTTAGGCAAAAGAGAAACAGTATAAAATATATTTAATTTAA
CAAAATTTGATTAAATTAAACTGCTAAATTTAATAAATATTAGGTAATCAGAATTTGCAA
AGAATTCGCAAGTAGCTCAGCTAAAATGCTTCTAATTTCTTACGAGTAATTTAGAATGCA
TGTAGAGACTTTATCTAATGCTTGTGACCTCTTAATTTTCGATGAAGGTCACAGACTCAA
AAACATGAATATCAAAACATTTAGATCTTTTAATTCAATTAAATGCAATAGGCGTATTAT
ACTAACTGGTACACCACTTCAGAACTCTTTAGATGAATTCTACTCTTGTGTTAAGTATAA
ATTATAATATCTTTTTATTATGAACTTAATTTTTTCTAATTAAAGGTTTGTTAACCCGAA
TATCTTTGAAAACGAAAAGTAGTTTAAATTTGTTTTTTCAGATCCTATTTTGGCAGCTTT
AAAAAGTGATGCTTCTGCAGATGCTGTCGAAAAGGCTGCTGTAAGAAGTAAAGAACTCAC
TCATATAATCAGTAGATTCGTTTTAAGAAGAAAGGCTGATATTTTGGAAAAATTATTACC
TCCTCGTTCTGAATACTTTATCTTTTTGAAGCTTACACCTTTTTAAAACATGTTATATAA
GAAGATGATATAAGCAAGATATAATAAAAGCGAACTTGATACTGGTGAAGGTGCTTTTGG
CCTTCTGACTATAATGAGAAAGTTACTCAATCACCCTTAGCTTATATACACTGATGTAGG
CAACGTAAATAAAATAATTATTTTTATATTTGATTAAATTAATAATCTATAATAAAAATA
GCAAACGTCTTAAGAGTTTAAGCAATATTTCCCTTAAGATTATCAACTTGATGATTGGGA
AGCTTCTTTTAAGTTTAAATTTATTTCAGATTTACTAGATTAAATGAGATAGATTGAAAT
AGCCTAAAAATCAACTGAAAGAATAATTATCGTATCTTATTGGACTTAAACTCTTGATGT
TCTATAAATTATGATCAAATAAAAAAATTTAAAATTTGTCCGTCTTGATGGTTCAGTGAA
TGCACAAAAAAGATAAGAATTGATTGATAGGTTAGAAATTTTTTTTGATTTTTCCAATAA
ATAGAAATATTTTCAACAAAAAGATTCTAAGACCCCACTAATGACATCAAAGTTTTCTTG
CTTTGTGGTAGTGCAGGTGGTACAGGTTTAAATCTTAGTGCAGCAAACAGAATGGTTTTA
ATGGAAGCTAACTGGAATCCTTCAAACGATTTATAGGTAATTAATCTTCATTAATTTTAG
AAAAATAAATTTTGGTTTAGTATCAAATTTTCACAGTTTGTATTGAAAAATGTTGTAATA
TTAATGCTTTTTTAATTTAAATTTCCTTTTTTAAATAATTTTTAAATATATTTAATTATC
TTTGGGTGATTTTTATAGATCATTATTGAATTTAATAGAATTATTAATTATATCAAATTT
TATCAATTAAGGTTATGGGAAGAATTTGGAGAGATGGATAAACAAAACCAGTGCATATTT
ACAGATTAGTTGCTTGTGGCACTATGGAAGAAAAAGTTCTACAGAGATAGTTCTTGAAAG
AAGACTTAAGTTAAAATGTAGTTGATGAAAAAATGATTGTTAAACAATATAATAATGATA
AACTAAAATAACTTTTTGAATTTAAGGGAGATAATTAATGTACCAGCTTTAAAGAAGATG
AAAATTAATTAAATTAATTAAAAGAGTTTACTCCTGATTATGTTGATACTATGGAGAAAT
ATATAACTTTTGTAAAGAGAACAATTAAGGGAGAAAAGAAAGATTAGGAGTAAGAGAGTG
AAAATGTAATTGATAATGCTTTTGATGAAGGAAATATTTTCTTAAAACCAGAAGCCTAAA
ATGAAGATGAAGCTGATGGAGAAGATTCATTAGATGATAAAGAAATTAATGAAGAAGAGG
AAGAAAAAATAAGAGAAGAATTAACTAAAGACATCTCTGAATCCACAGCAGCAACAGGAG
AGCTAAGCAGAATAATAGAGGAAGATGATAAAAATGTTAAAGAGTGTAATGAGAGTGATG
ATGATTTTGCTATATTTAATTATGCTAAAAAAAAGGATTCAGATAATGAATAACCCATAA
AAGAAATAAAGAATGAAGATCTTATAGATAACTAAATTGCAGCTGAAAAGGAGGAAGAAT
CATAAAATAAAGATAATAAAGAAGCAGATATGCAAGTTGAAGAAAAAGCTGAAGATGAAG
ATGAAGTTGTTGTAACAAAAGGCAGAAGAGGAAGAAGAAAAGCAACTACAACAAGTGATA
CTAATCCAGCCAAAAATATACTTAAAAAATTAAAAAAATGA