Identifiers and Description

Gene Model Identifier

TTHERM_00142330

Standard Name

RAD51 (Homolog of RADiation sensitive protein family 51)

Aliases

PreTt26639 | 11.m00336 | 3702.m00060

Description

RAD51 DNA repair RAD51-like protein; DNA repair protein RAD51 containing protein; strand exchange protein; involved in homologous recombination and repair of double-stranded DNA breaks

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00142330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04844.19.997093137033517e-262DNA repair protein RAD51 conta
ining protein (332 aa)
OxytrichaContig22030.0.g962.0004882463825047e-175Rad51
DictyBaseDDB_G02736114.0011977872964304e-148rad51-2 on chromosome: 2 posit
ion 3169189 to 3170422
SGDYER095W1.9991914687114462e-138RAD51 Strand exchange protein,
forms a helical filament with
DNA that searches for homolog
y; involved in the recombinati
onal repair of double-strand b
reaks in DNA during vegetative
growth and meiosis; homolog o
f Dmc1p and bacterial RecA pro
tein
WormBaseWBGene000042972.998573346093879e-125locus:rad-51 status:Confirme
d UniProt:L8E822 protein_i
d:CCQ25700.1
Stentor CoeruleusSteCoe_129303.5722699376192174e-67

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:21483758: Howard-Till RA, Lukaszewicz A, Loidl J (2011) The recombinases Rad51 and Dmc1 play distinct roles in DNA break repair and recombination partner choice in the meiosis of Tetrahymena. PLoS genetics 7(3):e1001359
  3. Ref:17005912: Yakisich JS, Sandoval PY, Morrison TL, Kapler GM (2006) TIF1 activates the intra-S-phase checkpoint response in the diploid micronucleus and amitotic polyploid macronucleus of Tetrahymena. Molecular biology of the cell 17(12):5185-97
  4. Ref:15522890: Loidl J, Scherthan H (2004) Organization and pairing of meiotic chromosomes in the ciliate Tetrahymena thermophila. Journal of cell science 117(Pt 24):5791-801
  5. Ref:15304567: Smith JJ, Cole ES, Romero DP (2004) Transcriptional control of RAD51 expression in the ciliate Tetrahymena thermophila. Nucleic acids research 32(14):4313-21
  6. Ref:11290715: Marsh TC, Cole ES, Romero DP (2001) The transition from conjugal development to the first vegetative cell division is dependent on RAD51 expression in the ciliate Tetrahymena thermophila. Genetics 157(4):1591-8
  7. Ref:10747055: Marsh TC, Cole ES, Stuart KR, Campbell C, Romero DP (2000) RAD51 is required for propagation of the germinal nucleus in Tetrahymena thermophila. Genetics 154(4):1587-96
  8. Ref:9628914: Campbell C, Romero DP (1998) Identification and characterization of the RAD51 gene from the ciliate Tetrahymena thermophila. Nucleic acids research 26(13):3165-72
  9. Ref:SUPR000219
  10. Ref:SUPR000164
  11. Ref:SUPR000124

Sequences

>TTHERM_00142330(coding)
ATGGCTGAGTACGCTGAAGACGTTGAATAAAGCGATGGACCTATGTTGATCGCCAAATTG
GAAGAACATGGTATTAATAATGCAGATGTTAAAAAACTCATAGATGCTGGTTTCCAAACT
GTTGAATCCATTTCTTACACTGCTAAGAAAAATCTCTTGCAAATTAAGGGTATGACTGAA
GCAAAAATCGATAAAATCCTTGATGTTGCTGCCAAATTAGTTCCTAATGATTTCTAAACT
GCAGCTGAATACTATGTAAAGAGACAAAGTGTCATCAATCTTACTACAGGCTCAACTGAA
TTAGACAAACTTCTTGGTGGTGGTTTTGAAACAGGCTCTCTCACTGAAATTTTTGGTGAA
TTCAGAACAGGTAAAACTTAAATTTGTCATACTTTGTGTATCACCTGCTAATTACCCAAG
GAAAAGGGTGGTGGTGAAGGTAAGGCTATGTATATTGATACTGAAGGTACTTTCAGACCT
GAAAGACTTGAATCAATTGCTGAAAGATTCGGATTAGATCCTCAAGAATGTATGGAAAAC
GTAGCTTATGCTAGAGCCTTCAACTGTGATCAATAAAATAAACTCTTAGTCCAGGCTGCT
GCTTTGATGGCTGAAAGTAAATACGCTTTGCTTATTGTTGATTCAGCCACTGCTCTTTAC
AGAACTGATTATAGTGGTAGAGGTGAATTGTCAGTCAGACAAAATCACTTGGGTAAATTC
TTGAGAAACTTATAAAGACTTGCTGACGAATTCGGTATTGCTGTAGTTATTACCAACCAA
GTTATGTCCTAAGTCGATGGTGCAGCTATGTTCGCTGGTGATATGAAGAAACCTATTGGT
GGTAATATTATGGCTCACGCTTCTACTACCAGACTTTATCTCAGAAAAGGTAGAGGAGAG
TCTCGTATTTGCAAAATTTACGATTCTCCATGTCTTCCTGAATCAGAAGCTATCTACGCT
ATTGGTAAGGGTGGTATTGAAGACTTCAACGAGTGA


>TTHERM_00142330(protein)
MAEYAEDVEQSDGPMLIAKLEEHGINNADVKKLIDAGFQTVESISYTAKKNLLQIKGMTE
AKIDKILDVAAKLVPNDFQTAAEYYVKRQSVINLTTGSTELDKLLGGGFETGSLTEIFGE
FRTGKTQICHTLCITCQLPKEKGGGEGKAMYIDTEGTFRPERLESIAERFGLDPQECMEN
VAYARAFNCDQQNKLLVQAAALMAESKYALLIVDSATALYRTDYSGRGELSVRQNHLGKF
LRNLQRLADEFGIAVVITNQVMSQVDGAAMFAGDMKKPIGGNIMAHASTTRLYLRKGRGE
SRICKIYDSPCLPESEAIYAIGKGGIEDFNE


>TTHERM_00142330(gene)
ATGGCTGAGTACGCTGAAGACGTTGAATAAAGCGATGGACCTATGTTGATCGCCAAATTG
GAAGAACATGGTATTAATAATGCAGATGTTAAAAAACTCATAGATGCTGGTTTCCAAACT
GTTGAATCCATTTCTTACACTGCTAAGAAAAATCTCTTGCAAATTAAGGGTATGACTGAA
GCAAAAATCGATAAAATCCTTGATGTTGCTGCCAAATTAGTTCCTAATGATTTCTAAACT
GCAGCTGAATACTATGTAAAGAGACAAAGTGTCATCAATCTTACTACAGGCTCAACTGAA
TTAGACAAACTTCTTGGTGGTGGTTTTGAAACAGGCTCTCTCACTGAAATTTTTGGTAAA
AATATTAATTAATTATTTGTTTATAAAATAGAATAATAAGTTTAAGAAATTAATATCAAA
TTTTAGCCACCATTTCTTTTTAAATATGATTTCCATCCATATTTATCATTAATTCTTAAA
AAATAGGTGAATTCAGAACAGGTAAAACTTAAATTTGTCATACTTTGTGTATCACCTGCT
AATTACCCAAGGAAAAGGGTGGTGGTGAAGGTAAGGCTATGTATATTGATACTGAAGGTA
CTTTCAGACCTGAAAGACTTGAATCAATTGCTGAAAGATTCGGATTAGATCCTCAAGAAT
GTATGGAAAACGTAGCTTATGCTAGAGCCTTCAACTGTGATCAATAAAATAAACTCTTAG
TCCAGGCTGCTGCTTTGATGGCTGAAAGTAAATACGCTTTGCTTATTGTTGATTCAGCCA
CTGCTCTTTACAGAACTGATTATAGTGGTAGAGGTGAATTGTCAGTCAGACAAAATCACT
TGGGTAAATTCTTGAGAAACTTATAAAGACTTGCTGACGAATTCGGTATTGCTGTAGTTA
TTACCAACCAAGTTATGTCCTAAGTCGATGGTGCAGCTATGTTCGCTGGTGATATGAAGA
AACCTATTGGTGGTAATATTATGGCTCACGCTTCTACTACCAGACTTTATCTCAGAAAAG
GTAGAGGAGAGTCTCGTATTTGCAAAATTTACGATTCTCCATGTCTTCCTGAATCAGAAG
TAATTCACTCATTCATTTATTAAATATATTTTTGCTTTGAAATAAATACACAAAAGTGTG
AGCCAAATAAATACGAATAATTTATTTTATCAATTTATATTAGAAAAAAAATACTTTATT
AAAAAATTTATTAATAATATTTGTTTAACTATAGGCTATCTACGCTATTGGTAAGGGTGG
TATTGAAGACTTCAACGAGTGA