Identifiers and Description

Gene Model Identifier

TTHERM_00142330

Standard Name

RAD51 (homolog of RADiation sensitive protein family)

Aliases

PreTt26639 | 11.m00336 | 3702.m00060

Description

DNA repair protein RAD51 containing protein; Strand exchange protein; involved in homologous recombination and repair of double-stranded DNA breaks

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00142330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04844.19.997093137033517e-262DNA repair protein RAD51 conta
ining protein (332 aa)
OxytrichaContig22030.0.g962.0004882463825047e-175Rad51
DictyBaseDDB_G02736114.0011977872964304e-148rad51-2 on chromosome: 2 posit
ion 3169189 to 3170422
SGDYER095W1.9991914687114462e-138RAD51 Strand exchange protein,
forms a helical filament with
DNA that searches for homolog
y; involved in the recombinati
onal repair of double-strand b
reaks in DNA during vegetative
growth and meiosis; homolog o
f Dmc1p and bacterial RecA pro
tein
WormBaseWBGene000042972.998573346093879e-125locus:rad-51 status:Confirme
d UniProt:L8E822 protein_i
d:CCQ25700.1
Stentor CoeruleusSteCoe_129303.5722699376192174e-67

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21483758: Howard-Till RA, Lukaszewicz A, Loidl J (2011) The recombinases Rad51 and Dmc1 play distinct roles in DNA break repair and recombination partner choice in the meiosis of Tetrahymena. PLoS genetics 7(3):e1001359
  2. Ref:17005912: Yakisich JS, Sandoval PY, Morrison TL, Kapler GM (2006) TIF1 activates the intra-S-phase checkpoint response in the diploid micronucleus and amitotic polyploid macronucleus of Tetrahymena. Molecular biology of the cell 17(12):5185-97
  3. Ref:15522890: Loidl J, Scherthan H (2004) Organization and pairing of meiotic chromosomes in the ciliate Tetrahymena thermophila. Journal of cell science 117(Pt 24):5791-801
  4. Ref:15304567: Smith JJ, Cole ES, Romero DP (2004) Transcriptional control of RAD51 expression in the ciliate Tetrahymena thermophila. Nucleic acids research 32(14):4313-21
  5. Ref:11290715: Marsh TC, Cole ES, Romero DP (2001) The transition from conjugal development to the first vegetative cell division is dependent on RAD51 expression in the ciliate Tetrahymena thermophila. Genetics 157(4):1591-8
  6. Ref:10747055: Marsh TC, Cole ES, Stuart KR, Campbell C, Romero DP (2000) RAD51 is required for propagation of the germinal nucleus in Tetrahymena thermophila. Genetics 154(4):1587-96
  7. Ref:9628914: Campbell C, Romero DP (1998) Identification and characterization of the RAD51 gene from the ciliate Tetrahymena thermophila. Nucleic acids research 26(13):3165-72
  8. Ref:SUPR000164
  9. Ref:SUPR000124

Sequences

>TTHERM_00142330(coding)
ATGGCTGAGTACGCTGAAGACGTTGAATAAAGCGATGGACCTATGTTGATCGCCAAATTG
GAAGAACATGGTATTAATAATGCAGATGTTAAAAAACTCATAGATGCTGGTTTCCAAACT
GTTGAATCCATTTCTTACACTGCTAAGAAAAATCTCTTGCAAATTAAGGGTATGACTGAA
GCAAAAATCGATAAAATCCTTGATGTTGCTGCCAAATTAGTTCCTAATGATTTCTAAACT
GCAGCTGAATACTATGTAAAGAGACAAAGTGTCATCAATCTTACTACAGGCTCAACTGAA
TTAGACAAACTTCTTGGTGGTGGTTTTGAAACAGGCTCTCTCACTGAAATTTTTGGTGAA
TTCAGAACAGGTAAAACTTAAATTTGTCATACTTTGTGTATCACCTGCTAATTACCCAAG
GAAAAGGGTGGTGGTGAAGGTAAGGCTATGTATATTGATACTGAAGGTACTTTCAGACCT
GAAAGACTTGAATCAATTGCTGAAAGATTCGGATTAGATCCTCAAGAATGTATGGAAAAC
GTAGCTTATGCTAGAGCCTTCAACTGTGATCAATAAAATAAACTCTTAGTCCAGGCTGCT
GCTTTGATGGCTGAAAGTAAATACGCTTTGCTTATTGTTGATTCAGCCACTGCTCTTTAC
AGAACTGATTATAGTGGTAGAGGTGAATTGTCAGTCAGACAAAATCACTTGGGTAAATTC
TTGAGAAACTTATAAAGACTTGCTGACGAATTCGGTATTGCTGTAGTTATTACCAACCAA
GTTATGTCCTAAGTCGATGGTGCAGCTATGTTCGCTGGTGATATGAAGAAACCTATTGGT
GGTAATATTATGGCTCACGCTTCTACTACCAGACTTTATCTCAGAAAAGGTAGAGGAGAG
TCTCGTATTTGCAAAATTTACGATTCTCCATGTCTTCCTGAATCAGAAGCTATCTACGCT
ATTGGTAAGGGTGGTATTGAAGACTTCAACGAGTGA


>TTHERM_00142330(protein)
MAEYAEDVEQSDGPMLIAKLEEHGINNADVKKLIDAGFQTVESISYTAKKNLLQIKGMTE
AKIDKILDVAAKLVPNDFQTAAEYYVKRQSVINLTTGSTELDKLLGGGFETGSLTEIFGE
FRTGKTQICHTLCITCQLPKEKGGGEGKAMYIDTEGTFRPERLESIAERFGLDPQECMEN
VAYARAFNCDQQNKLLVQAAALMAESKYALLIVDSATALYRTDYSGRGELSVRQNHLGKF
LRNLQRLADEFGIAVVITNQVMSQVDGAAMFAGDMKKPIGGNIMAHASTTRLYLRKGRGE
SRICKIYDSPCLPESEAIYAIGKGGIEDFNE


>TTHERM_00142330(gene)
ATGGCTGAGTACGCTGAAGACGTTGAATAAAGCGATGGACCTATGTTGATCGCCAAATTG
GAAGAACATGGTATTAATAATGCAGATGTTAAAAAACTCATAGATGCTGGTTTCCAAACT
GTTGAATCCATTTCTTACACTGCTAAGAAAAATCTCTTGCAAATTAAGGGTATGACTGAA
GCAAAAATCGATAAAATCCTTGATGTTGCTGCCAAATTAGTTCCTAATGATTTCTAAACT
GCAGCTGAATACTATGTAAAGAGACAAAGTGTCATCAATCTTACTACAGGCTCAACTGAA
TTAGACAAACTTCTTGGTGGTGGTTTTGAAACAGGCTCTCTCACTGAAATTTTTGGTAAA
AATATTAATTAATTATTTGTTTATAAAATAGAATAATAAGTTTAAGAAATTAATATCAAA
TTTTAGCCACCATTTCTTTTTAAATATGATTTCCATCCATATTTATCATTAATTCTTAAA
AAATAGGTGAATTCAGAACAGGTAAAACTTAAATTTGTCATACTTTGTGTATCACCTGCT
AATTACCCAAGGAAAAGGGTGGTGGTGAAGGTAAGGCTATGTATATTGATACTGAAGGTA
CTTTCAGACCTGAAAGACTTGAATCAATTGCTGAAAGATTCGGATTAGATCCTCAAGAAT
GTATGGAAAACGTAGCTTATGCTAGAGCCTTCAACTGTGATCAATAAAATAAACTCTTAG
TCCAGGCTGCTGCTTTGATGGCTGAAAGTAAATACGCTTTGCTTATTGTTGATTCAGCCA
CTGCTCTTTACAGAACTGATTATAGTGGTAGAGGTGAATTGTCAGTCAGACAAAATCACT
TGGGTAAATTCTTGAGAAACTTATAAAGACTTGCTGACGAATTCGGTATTGCTGTAGTTA
TTACCAACCAAGTTATGTCCTAAGTCGATGGTGCAGCTATGTTCGCTGGTGATATGAAGA
AACCTATTGGTGGTAATATTATGGCTCACGCTTCTACTACCAGACTTTATCTCAGAAAAG
GTAGAGGAGAGTCTCGTATTTGCAAAATTTACGATTCTCCATGTCTTCCTGAATCAGAAG
TAATTCACTCATTCATTTATTAAATATATTTTTGCTTTGAAATAAATACACAAAAGTGTG
AGCCAAATAAATACGAATAATTTATTTTATCAATTTATATTAGAAAAAAAATACTTTATT
AAAAAATTTATTAATAATATTTGTTTAACTATAGGCTATCTACGCTATTGGTAAGGGTGG
TATTGAAGACTTCAACGAGTGA