Identifiers and Description

Gene Model Identifier

TTHERM_00773790

Standard Name

RAD50 (Homolog of budding yeast Rad50)

Aliases

PreTt04470 | 128.m00148 | 3676.m00073

Description

Required for the formation and repair of meiotic double-strand breaks

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00606 ) rad50
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00038 ) Intermediate filament protein
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF02609 ) exodeoxyribonuclease VII, small subunit
  • ( TIGR00611 ) DNA replication and repair protein
  • ( TIGR01166 ) cobalt ABC transporter, ATP-binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00773790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17705.19.997093137033517e-262hypothetical protein (1304 aa)
OxytrichaContig17805.0.g22.9989272749380808e-50AAA domain
SGDYNL250W1.000499495426459e-47RAD50 Subunit of MRX complex,
with Mre11p and Xrs2p, involve
d in processing double-strand
DNA breaks in vegetative cells
, initiation of meiotic DSBs,
telomere maintenance, and nonh
omologous end joining
DictyBaseDDB_G02927866.002397656030775e-43rad50 on chromosome: 6 positio
n 2029933 to 2034102
WormBaseWBGene000042966.99697739292434e-35locus:rad-50 DNA repair prot
ein rad-50 status:Confirmed
UniProt:O44199 protein_id:
CAB01581.1
Stentor CoeruleusSteCoe_184114.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00773790(coding)
ATGTCTTACTTAAAAAAGCTAGGAATTTACGGAATCAGAAGTTATGGGGATTAAAACAGT
GAAAAGTATGAAGAAATAGCCTTCTTTAAACCTTTAACTCTGATTTTAGGTAACAACGGA
GCTGGCAAGTCAACTATAATAGAATGCTTAAAACTAATCACTACTGGTTCTTTTCCTCCA
AACTCTGACAAAGGAAAAACATTTATTAAGGATCCAAGATTGATGGGTTCAAATGAGAGT
TAGGGGTCAATTTCGTTAATTTTCAAGGCTATTAATCAAAAATAAATATTAGTTAGAAGA
CTATTCTAGGTAAAAAAAGAAAAGAGTGGAAAATTTACATTTGATTCGAAAGATGCTACG
ATTAAAGTTAGAGATAAGAATACAGGAAAGGATATCTCTGTAGATCATAAATGTTTAGAA
ATTGAAAAATAAGTCCCACAGTTATTAGGTGTTAGTAAAGCTGTTTTTGAAAATGTTATC
TTTTGTCACTAAGATGAAAGTCTTTGGCCATTTGGTGACAGTGCAACATTAAAAAGTATT
TTCGATGAACTTTTCGATACTAAACAATTCACAAAACTTTAAGAAACTTTGCATAAGTAA
CAGAAAGAAATTAAAAAAGAAGCTTCAGAAACGAAAATTAATTTGTAGCACTACAAGCAA
AGATATGATGAGGCTGTTTCTCAGAAATAGTTGATTGCAAAAGAAGCAGAAGATTTACTC
TAAGCTACTGTAGATCTTGAAAAAATGAGAAACGAATATAATTTGTTTAATAAAGGAATT
GAAGATGAAGAAACAGTCAGAATAAGGATAGAAAACTTAAATAAAGATATTTGCAATTGT
AATTGGAACAAAAATGAAATGGAAAAATAGTAGAAATAAATATTAAGTAGCTGCAGTAGA
CACTATTTTTTAGGTGAAGATATTGATACACTAAAAAAAATATAAGATCATCTTAAGAAA
GAAAACTAAGATTTGAAGATAAAGAAAGAGGAAATTGAAGAAAGTATTGAAACAGAAAAA
AGGGATTTAGATAAGTTGAAGTATGAAATAGAAAATTTGAAATCATCAGATAAGAATACT
AAATAAGTTCATTAAGATCTCAAAAACATTAAATAAAAATTAAATGAAATTATGCATAAA
TCTATTGATTCTGATGAGATTATGCTGAAAGAGGCTAACCAATATAAAGATTAAATAGAA
TCAGAATATAAAACATTATCATTTTCTTTAAAAAACTCTGTACAGGAATATCAAGATACT
ATTCACTAAACATAGCAAAATTTACAAAAACTTTAAGTAAGGTAAGCTGAACTTAAAGAA
AAAAAAAAGCACTCTCAAAAGAGAATTGAATAGCTTTAAGAAGAAATTGGAAAACTAAAA
TCTTCAAACACTCAAAAAAATTTAGAAGAGTCAATTTAATTATTGGAGGTGTCTAAAAAA
AATAGTGAACAATATAACTTAAAGATATAAGAATACTAAGACTAAATAGATAATATTAGA
TAGCAAAATTCTGGATTAGCAAAATAAATTGAAATTATTAACTCATAGTCTAAAATGCAA
AGTAAATATTTAGAGCTAAAATAAATGACAAGCTAGTTTGATGAAATAAATAAAACTATG
GAGGTTTAGCAAAAAGAATACGAATAATATTAAATTTCACAAGACGAACATTTGAGTGAG
CAAAGAAAGTAATGCATGGGTGAAATAAGTAGCTTAAAGTAGCAAAAATCGAAACTTGAG
TCAGAAATTTCGAAATTAGAAGGTAGAATAGAGCTAAATGAAGACATAGAAACAGCTTTT
GAATTAAAACTAAATCAAATAACTTAAACTTTTAAAGAAAGTAATTTACTCGATATTATT
GCTTAAGACAATAATGCAGATTTTGATACAAAATACTAATCAATTAAAGAAGAAATAGAA
GAATTAAAAAATAGCATTATTGAAAAGCAAACTTGCTTATTAATTGATAAATAAGTTCTA
AATTATTGCACTGAGAAGAAAAAGTGCAAATTTTGTAAAAGTGATGTTAATGAAGATAAT
ATATCCAAAATAACTAAATCCTAAGAAGATAGATCAAGAAAAGCAGAAAAAGATATACAA
GAGCGTATTGCCCTTAAAGAATAAAAAATATTTGAGAAAAAATAATTGAAAAAACTCAAG
GAATAGTACGTTTAGTATAATGAATTGAGGGCTAAATAAAAAAAGAATAACTCTGAGATT
AAAGAGATATAAATTCAGGTTAAAGAACTACAAGAGCAATTATAAAATTTAGTCAATTAA
CTTATTAATAAAGAAGCTCAATTAGCTAAACTAGAAAAAGCACATACTATTTAAAGTGAA
ATCATTAAAACATAAAGATAAATTTATAACTTGAAGAATAAAATTCAGAAATTTTAAGTT
GAAAATCCTGAATTACTAAATATTGATAATTAAAATATTATACCACCAGAAAAAGTTGAA
GAAATCCATAAAAACTATAAGCAAAATAACTAAAGGTTAGAGTCTTTGAACAGCCTGCTT
ATTTAAGAAAATAACAAAAAAGCGAACTCTAATGCTAGTTTTCAATAAGCAGAAGTGTTA
AGAAAAAACTGCTAAAATAAGCTAAAAGAAGAACAAGAGCAAATTCAAAGAAACACAAAA
GATATTAAAGATTATGAATAATAAAATTAAACATCTCTCACTGAACTATAAAATATTGAA
AAAGATATAGAATCATAAAACAAATTATTATAAGAGCTTAAAAAAAATGTAAGTGAATAA
ACACAAGAGCTTTAGAAAGTTTAATAAACTTACGACTAATCCAAAATACTGATTGGCGAA
TACCTTCCTAAATACGAAAAGACCTATACAGAATATAAAGAACTTAAGCAAGCCAAAGGA
AAGTAAAAAAGTAAATTATAAGAAAATTAAATCGCTTAATTAGAAAAGGAGTATGCTATC
AAGGAAAAATCGAAATAATAAAATGAAGAAGAACTAGTAAAGATTATAGAGTAACTGAAA
GAACAGACTGAAGAATTTGACAATCTTACAAAAGGTATCTAATATCTAGAACTTGGTGTT
TCTATATCTTAGGTGGAAAAAGAGTTAGCTCAAAATGAACAACTTCTCAAAGAATAGTAA
GCAATTTTAGAGAAAATCTAACAATAAACGAGAGCAGGATATGATAAAATACAAAAAATA
AAAGCTTTTGAAGAAACCTGCAAATATAGAAAATAAGCTTTAGAAAAAAATTATGCAGAG
GCAATAGCCAGATATGATCAGGCTGAAGAAAGATATTGTAGAGCACTAGTTGAGTTAGAA
GTAAAAAATGGATTGCTAAAAGACATCTAAGAATACTTAGAGGAGCTTGATAAAACACTA
ATTAACTATCATAAGGATAAGATGGAATAAATTAATAAATGCATTGCAGATACTTGGAAA
AAAATTTATTAAGGCTAAGATATTGTTAAAGTTGAGATCAAAGCAGAAGAAGCAGAAGGA
AGAGGCAAAAAAATATATAACTATAGAATTGTTATGTTTATCTACGACGAAAAGGATAAA
GATCTCAAAGAGATAGATATGAAAGGCAGATGTAGTGCTGGTTAAAAAGTTCTTGCTTCA
ATCATTATTAGGTTAGCATTAGCTGAAGCATTTACTATGAATTGTGGTATCCTTGCACTT
GATGAGCCTACAACAAATCTTGATAAGCTTCATGCCTAAAAATTGGGAGAGCAACTATGT
GAACTTATAGAGTCCAGAAAAGGATAATCGTCTTTCCAACTTATCATAATTTCACATGAT
AAAGATTTTATTCATTTAATGTAGCAGAGATAACATTGTAGTGACTTCTACTACGTATAT
AAGGAAAATGGATGTTCTCTAATTGAAAGAAGAACTTATAAAAATGCTTTGATGAACAAG
TAAACAGATTGA


>TTHERM_00773790(protein)
MSYLKKLGIYGIRSYGDQNSEKYEEIAFFKPLTLILGNNGAGKSTIIECLKLITTGSFPP
NSDKGKTFIKDPRLMGSNESQGSISLIFKAINQKQILVRRLFQVKKEKSGKFTFDSKDAT
IKVRDKNTGKDISVDHKCLEIEKQVPQLLGVSKAVFENVIFCHQDESLWPFGDSATLKSI
FDELFDTKQFTKLQETLHKQQKEIKKEASETKINLQHYKQRYDEAVSQKQLIAKEAEDLL
QATVDLEKMRNEYNLFNKGIEDEETVRIRIENLNKDICNCNWNKNEMEKQQKQILSSCSR
HYFLGEDIDTLKKIQDHLKKENQDLKIKKEEIEESIETEKRDLDKLKYEIENLKSSDKNT
KQVHQDLKNIKQKLNEIMHKSIDSDEIMLKEANQYKDQIESEYKTLSFSLKNSVQEYQDT
IHQTQQNLQKLQVRQAELKEKKKHSQKRIEQLQEEIGKLKSSNTQKNLEESIQLLEVSKK
NSEQYNLKIQEYQDQIDNIRQQNSGLAKQIEIINSQSKMQSKYLELKQMTSQFDEINKTM
EVQQKEYEQYQISQDEHLSEQRKQCMGEISSLKQQKSKLESEISKLEGRIELNEDIETAF
ELKLNQITQTFKESNLLDIIAQDNNADFDTKYQSIKEEIEELKNSIIEKQTCLLIDKQVL
NYCTEKKKCKFCKSDVNEDNISKITKSQEDRSRKAEKDIQERIALKEQKIFEKKQLKKLK
EQYVQYNELRAKQKKNNSEIKEIQIQVKELQEQLQNLVNQLINKEAQLAKLEKAHTIQSE
IIKTQRQIYNLKNKIQKFQVENPELLNIDNQNIIPPEKVEEIHKNYKQNNQRLESLNSLL
IQENNKKANSNASFQQAEVLRKNCQNKLKEEQEQIQRNTKDIKDYEQQNQTSLTELQNIE
KDIESQNKLLQELKKNVSEQTQELQKVQQTYDQSKILIGEYLPKYEKTYTEYKELKQAKG
KQKSKLQENQIAQLEKEYAIKEKSKQQNEEELVKIIEQLKEQTEEFDNLTKGIQYLELGV
SISQVEKELAQNEQLLKEQQAILEKIQQQTRAGYDKIQKIKAFEETCKYRKQALEKNYAE
AIARYDQAEERYCRALVELEVKNGLLKDIQEYLEELDKTLINYHKDKMEQINKCIADTWK
KIYQGQDIVKVEIKAEEAEGRGKKIYNYRIVMFIYDEKDKDLKEIDMKGRCSAGQKVLAS
IIIRLALAEAFTMNCGILALDEPTTNLDKLHAQKLGEQLCELIESRKGQSSFQLIIISHD
KDFIHLMQQRQHCSDFYYVYKENGCSLIERRTYKNALMNKQTD


>TTHERM_00773790(gene)
ATGTCTTACTTAAAAAAGCTAGGAATTTACGGAATCAGAAGTTATGGGGATTAAAACAGT
GAAAAGTATGAAGAAATAGCCTTCTTTAAACCTTTAACTCTGATTTTAGGTAACAACGGA
GCTGGCAAGTCAGTAATATTTTTATTTTTTAATAATTTAACAAAGTTAACTTAAACTTAT
TTAGACTATAATAGAATGCTTAAAACTAATCACTACTGGTTCTTTTCCTCCAAACTCTGA
CAAAGGAAAAACATTTATTAAGGATCCAAGATTGATGGGTTCAAATGAGAGTTAGGGGTC
AATTTCGTTAATTTTCAAGGCTATTAATCAAAAATAAATATTAGTTAGAAGACTATTCTA
GGTAATTTTAAATAATAATTCTTAATCAACAACTAAAATAAGTATTTTATACAAGGTAAA
AAAAGAAAAGAGTGGAAAATTTACATTTGATTCGAAAGATGCTACGATTAAAGTTAGAGA
TAAGAATACAGGAAAGGATATCTCTGTAGATCATAAAGTATAAATAAAATATATAATTTT
GACTTATCTTATAAATAATTTTATTTATTTTTAAGTGTTTAGAAATTGAAAAATAAGTCC
CACAGTTATTAGGTGTTAGTAAAGCTGTTTTTGAAAATGTTATCTTTTGTCACTAAGATG
AAAGTCTTTGGCCATTTGGTGACAGTGCAACATTAAAAAGTATTTTCGATGAACTTTTCG
ATACTAAACAGTAATACAAATAAAAATAATTAATTTTTTTTTCTTTAATATTTCACAATC
TTAGAATATACTTAATTAAATAATAAAAAGATTCACAAAACTTTAAGAAACTTTGCATAA
GTAACAGAAAGAAATTAAAAAAGAAGCTTCAGAAACGAAAATTAATTTGTAGCACTACAA
GCAAAGATATGATGAGGCTGTTTCTCAGAAATAGTTGATTGCAAAAGAAGCAGAAGATTT
ACTCTAAGCTACTGTAGATCTTGAAAAAATGAGAAACGAATATAATTTGTTTAATGTAAT
TTATTTAAAATTTTAAAATAAGTAAAAAAGCTTTATTTTTGATTTTAGAAAGGAATTGAA
GATGAAGAAACAGTCAGAATAAGGATAGAAAACTTAAATAAAGATATTTGCAATTGTAAT
TGGAACAAAAATGAAATGGAAAAATAGTAGAAATAAATATTAAGTAGCTGCAGTAGACAC
TATTTTTTAGGTGAAGATATTGATACACTAAAAAAAATATAAGATCATCTTAAGAAAGAA
AACTAAGATTTGAAGATAAAGAAAGAGGAAATTGAAGAAAGTATTGAAACAGAAAAAAGG
GATTTAGATAAGTTGAAGTATGAAATAGAAAATTTGAAATCATCAGATAAGAATACTAAA
TAAGTTCATTAAGATCTCAAAAACATTAAATAAAAATTAAATGAAATTATGCATAAATCT
ATTGATTCTGATGAGATTATGCTGAAAGAGGCTAACCAATATAAAGATTAAATAGAATCA
GAATATAAAACATTATCATTTTCTTTAAAAAACTCTGTACAGGAATATCAAGATACTATT
CACTAAACATAGCAAAATTTACAAAAACTTTAAGTAAGGTAAGCTGAACTTAAAGAAAAA
AAAAAGCACTCTCAAAAGAGAATTGAATAGCTTTAAGAAGAAATTGGAAAACTAAAATCT
TCAAACACTCAAAAAAATTTAGAAGAGTCAATTTAATTATTGGAGGTGTCTAAAAAAAAT
AGTGAACAATATAACTTAAAGATATAAGAATACTAAGACTAAATAGATAATATTAGATAG
CAAAATTCTGGATTAGCAAAATAAATTGAAATTATTAACTCATAGTCTAAAATGCAAAGT
AAATATTTAGAGCTAAAATAAATGACAAGCTAGTTTGATGAAATAAATAAAACTATGGAG
GTTTAGCAAAAAGAATACGAATAATATTAAATTTCACAAGACGAACATTTGAGTGAGCAA
AGAAAGTAATGCATGGGTGAAATAAGTAGCTTAAAGTAGCAAAAATCGAAACTTGAGTCA
GAAATTTCGAAATTAGAAGGTAGAATAGAGCTAAATGAAGACATAGAAACAGCTTTTGAA
TTAAAACTAAATCAAATAACTTAAACTTTTAAAGAAAGTAATTTACTCGATATTATTGCT
TAAGACAATAATGCAGGTATTTAAAAAAAAAATATATAATTGTTTTCTAAAAAATAAATT
TTTTTACTATAGATTTTGATACAAAATACTAATCAATTAAAGAAGAAATAGAAGAATTAA
AAAATAGCATTATTGAAAAGCAAACTTGCTTATTAATTGATAAATAAGTTCTAAATTATT
GCACTGAGAAGAAAAAGTGCAAATTTTGTAAAAGTGATGTTAATGAAGATAATATATCCA
AAATAACTAAATCCTAAGAAGATAGATCAAGAAAAGCAGAAAAAGATATACAAGAGCGTA
TTGCCCTTAAAGAATAAAAAATATTTGAGAAAAAATAATTGAAAAAACTCAAGGAATAGT
ACGTTTAGTATAATGAATTGAGGGCTAAATAAAAAAAGAATAACTCTGAGATTAAAGAGA
TATAAATTCAGGTTAAAGAACTACAAGAGCAATTATAAAATTTAGTCAATTAACTTATTA
ATAAAGAAGCTCAATTAGCTAAACTAGAAAAAGCACATACTATTTAAAGTGAAATCATTA
AAACATAAAGATAAATTTATAACTTGAAGAATAAAATTCAGAAATTTTAAGTTGAAAATC
CTGAATTACTAAATATTGATAATTAAAATATTATACCACCAGAAAAAGTTGAAGAAATCC
ATAAAAACTATAAGCAAAATAACTAAAGGTTAGAGTCTTTGAACAGCCTGCTTATTTAAG
AAAATGTAATTTAATTATTATTTAATTTTAATTAAATATTATTAATTTATAGAACAAAAA
AGCGAACTCTAATGCTAGTTTTCAATAAGCAGAAGTGTTAAGAAAAAACTGCTAAAATAA
GCTAAAAGAAGAACAAGAGCAAATTCAAAGAAACACAAAAGATATTAAAGATTATGAATA
ATAAAATTAAACATCTCTCACTGAACTATAAAATATTGAAAAAGATATAGAATCATAAAA
CAAATTATTATAAGAGCTTAAAAAAAATGTAAGTGAATAAACACAAGAGCTTTAGAAAGT
TTAATAAACTTACGACTAATCCAAAATACTGATTGGCGAATACCTTCCTAAATACGAAAA
GACCTATACAGAATATAAAGAACTTAAGCAAGCCAAAGGAAAGTAAAAAAGTAAATTATA
AGAAAATTAAATCGCTTAATTAGAAAAGGAGTATGCTATCAAGGAAAAATCGAAATAATA
AAATGAAGAAGAACTAGTAAAGATTATAGAGTAACTGAAAGAACAGACTGAAGAATTTGA
CAATCTTACAAAAGGTATCTAATATCTAGAACTTGGTGTTTCTATATCTTAGGTGGAAAA
AGAGTTAGCTCAAAATGAACAACTTCTCAAAGAATAGTAAGCAATTTTAGAGAAAATCTA
ACAATAAACGAGAGCAGGATATGATAAAATACAAAAAATAAAAGCTTTTGAAGAAACCTG
CAAATATAGAAAATAAGCTTTAGAAAAAAATTATGTAAAACTTTTAAATTTTTAAATTAA
TAAAAAATTAAAATTATATATTAGGCAGAGGCAATAGCCAGATATGATCAGGCTGAAGAA
AGATATTGTAGAGCACTAGTTGAGTTAGAAGTAAAAAATGGATTGCTAAAAGACATCTAA
GAATACTTAGAGGAGCTTGATAAAACACTAATTAACTATCATAAGGATAAGATGGAATAA
ATTAATAAATGCATTGCAGATACTTGGAAAGTAAAAATACTAAAAGCAAATAATTTATTA
AATTTATTTTATTTTAGAAAATTTATTAAGGCTAAGATATTGTTAAAGTTGAGATCAAAG
CAGAAGAAGCAGAAGGAAGAGGCAAAAAAATATATAACTATAGAATTGTTATGTTTATCT
ACGAGTAAATAAATAAATAACTTACTTATTTACTTTCTTTCTTTATTCCTAATTTTTAAT
TTATAAAATATTTTAAAAAGCGAAAAGGATAAAGATCTCAAAGAGATAGATATGAAAGGC
AGATGTAGTGCTGGTTAAAAAGTTCTTGCTTCAATCATTATTAGGTTAGCATTAGCTGAA
GCATTTACTATGAATTGTGGTATCCTTGCACTTGATGAGCCTACAACAAATCTTGATAAG
CTTCATGCCTAAAGTAAATAATATTTTCGTTAACATTCTAAACTTATAAAATATTTTTTA
GAATTGGGAGAGCAACTATGTGAACTTATAGAGTCCAGAAAAGGATAATCGTCTTTCCAA
CTTATCATAATTTCACATGATAAAGATTTTATTCATTTAATGTAGCAGAGATAACATTGT
AGTGACTTCTACTACGTATATAAGGTAAATTTCATAATTTTATAATAAAACAAAATATTG
AATGATATTCTAATAAATATAAAATAAGGAAAATGGATGTTCTCTAATTGAAAGAAGAAC
TTATAAAAATGCTTTGATGAACAAGTAAACAGATTGA