Identifiers and Description

Gene Model Identifier

TTHERM_00037210

Standard Name

RAD5 (RADiation sensitive protein family 5)

Aliases

PreTt14456 | 2.m02413 | 3825.m02825

Description

SNF2 family amine-terminal protein; SNF2 family N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00037210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00974.19.997093137033517e-262SNF2 family domain-containing
protein (1516 aa)
SGDYLR032W4.99876080819921e-108RAD5 DNA helicase proposed to
promote replication fork regre
ssion during postreplication r
epair by template switching; R
ING finger containing ubiquiti
n ligase; stimulates the synth
esis of free and PCNA-bound po
lyubiquitin chains by Ubc13p-M
ms2p
Stentor CoeruleusSteCoe_196839.462629465836378e-57
DictyBaseDDB_G02821153.00017180903994e-49DDB_G0282115 on chromosome: 3
position 5399711 to 5404710
WormBaseWBGene000100612.9990874792167046e-33status:Partially_confirmed U
niProt:G5EEW5 protein_id:CAB
05213.1
OxytrichaContig13957.0.g36.999211576891585e-27SNF2 family N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00037210(coding)
ATGAATAATCATATATAAATTGAAATGGAATACTATTAAAGTTTATATGACTCTTTTGTT
GCTATTGTAGGAGAAGGTGTTTGCACAGATGATGAAATCAAAAAATATATTTAGTGGGGC
AATGGAAATCTAGAGATATCCTTGAATTATTATTTTTAATAGCAAACAAAAAGCAGTGGA
TTTCAATCTATATCTTAAAAAAATTAATCTACTTCCATAAAAAACAATTCTAGCTAATAA
AATGGTATGAAAACAAGGCAAAGAAGTCAAAACTAGCAAAAACAATAAAATAGAGATAGC
AATAATAACAATTAAGCCAAATTATAATAGGCTGTTCCTCAATCGCAAAAATCAAAAGCT
CTCAATAATGATCTCAGTCAATAAAGGGATACTAGTTTTTAATAAGATGAAGAAGACAAA
TATTAGGAATTTCCGAAACAGTAAACAGTAAATGCATTCTAAAAATTATAAGAAGGAAGC
AAAAAAATGAGGGAGTTTGATAAAATTATTGAGTAGCTCAAAGAAGAGTATAAAAAACCA
GTATAATCAATTGTAGAAAAGAAGCTTTCTGTTAATAAAGATGAGTATAGCAATGATTTT
AACAAAGACTAGATCTATTAAGAACATAGTGAAGATAATTCTTTCAATGTAAACCTTGAT
TATTTACCATCTATCTTGAGACGCCCGAATCCCGAAGAAGCACACTATGAATCGTTTGAA
TAAGGAATTAAAGATGTTAAGTAAAGTGAAGAATAAAGCTTGCAGTTTCCTTGCTACTTG
GGACAGTTTATTTTAACAGGGCATGCACTCACTTCTTCAAGATGTGATATGAAAAAAGGA
GATGATGTCATATTAAAAATCGAAAGAAATGTTTAAACAAATATTGCTAAGAATAAACAA
AAAGCTAAAAAAAGTGGGGGTTAAACAACTTAGTAAATGATTATTAGGCTTGTTTGGAGA
GAAAGAGAAGTTGGAAGGTTAGATAATAACTATGCACAAGTTCTCTATCCTTTGATAGAT
AGAAATTATATATTTATTTAAGGTTAATTTGAATATGCCCCACCATATCTCTAAGCTTTT
ACCTAAATCAGAGTATCAGTCAAAGTGTCTCTACTAAAAACATGTATAACCAAACCAATC
ACTTAAATTATAGAAGAAAATTCTAATACAAAGGAAAGTCAAATTCTCAGAATATACAGT
GAAACTAAAGATTAATTTGCTCAACTCTTTGAGTGGTTAAATATGTAGATGGTAACTCCC
ACCTTAATTCAAGTGAAGGGTAAGAAGAAAAATTAACAAATTAATAGTAAAGAAAGAGAT
TCAATAGCAAATAATAGAAGCAGTTTTAATGAATTAAATAATTAAAATTAAGGATAAAAT
TTCCAAAATTCATTAAAAAAAGAAACTTTAAGTGATGATAAAGGGTTTGAAGAAGAATAA
AATGAACAAAAAAAAAACTCCAGTAAGATGCTCTCTGAAGATGAAGAAAGAGAGAGCTAC
TAAAATGAATCTAGTGATGGTTAGAAACTATAAGAAGATATATTTGGAAACCTACAAGAA
GCTGAGTAAGACAGTAAAAGAATGATAGCTGAAGAAGAAAGCTTAGATATTTCTTAAGAA
ATAAACAATATTTTAAATGATTAAAGCAAGTCAAATAATAATAGTTGTAATAATAAATAT
ACTCATTAAGATGCAACTAGTTCTGCACCAAAAATTAATTTGAATGACCCATTTATTAAG
CTTCCAAAATAGAAAACCCTTTTTAGCTTCAAATTGTAAAATAAGAAACCAGATTAAAAT
TAGGAGTAACAAGAAAGATCTGTTCGTTAAAGCAACAACTAGCAAGTTGCAGAAAACAAA
GAAGAAAATAAATCTCAAGACCTAGATTATGAGCAATTATTTAACATTGTCCCTGGCACA
GATGGCTAAGTAACTGAACTTTAATACTCAGAGCCACCTTCCACATTTAAAACATCTCTT
CACAATTATTAAAAATAAGCTCTAACATGGATGCTCTCTCGTGAAGGTAAATAAACTGAC
ATGAATGAAATTATTAAAAGAGATACAAGAACTTTGCACCCTTTATGGGAAAAATATGCT
TTGCCTTGCTCATTGAAATTCTTTTTATATTTTAATCCTTATTCGGGATAAGTCAGTACT
TAATTTCCTAGAGCTTAAAGTGATTGTAGAGGTGGTATTCTTGCTGATGAAATGGGTTTG
GGTAAAACTGTAATGATGCTCAGTCTTATACATTCCAACAAAAGAAAAAATCACTAATAT
ATTGCAAATATAAAAGAAGAGGACGAAACTGATTTAACAGATGATTTAAACAATTTTCTA
AGTCTAAAAGGAGGAAATACAGGTTAACAAAACCAAACCACTATAACAGCCGCATTTAAA
CCAAAGCAAAAGAACCAAACTCTGGTTTAAATGGCTAAGAAAGATGCAGGTACTTTAATT
ATTGTTCCTGTAACTCTCCTTCAATAATGGATGGACGAAATTTAATGTCATTCATCACAA
AACAGTCTAACCTATTATGCATATTATGGAAATAACAGAGAAAATAATTTAAACATTTAT
GATGTAGTTATCACTACTTACGGAACTATTTCGAGTGAATTTGCATCTTAATCAAACTTA
AATAATAAAAATCTTTACAAATTTAATTGGCATAGAATAGTGCTTGATGAAGCTCATTAC
ATAAAAGGGAGAGTTATATAAATAGCAAAGGCTGTTTACAGTCTTTCAGGTGATAATAGG
TGGTGTATGACAGGAACACCACTACAAAATAAGCTAGATGAGTTGTTTCCTTTAATTCAC
TTTATCAAACTTGAACCATGGAGTGATTATATTTGGTTCAATAATTATATAAACAAGCCT
CATGAGAAAGGTGATTTAGTTGTTTACGATGTCCTTAAAACTATCTTACGTCCTATATTG
CTTAGAAGAACCAAAAAGAGCAAAGATATTCATGGAAGAAGTATTATTAGCCTTCCAGAG
AAACATTGCTTCATAGAGAAAGTTGAGTTCACTCCTGAAGAAAGAATGTTTTATGACAAA
GTTCACCAAACTTCCAAAGAAGAATTTGATGGATTTCTATCTCAAGGCGTCCTTCTTTCT
AATTATATGAAAGTGTTCGAGCTTCTATTAAGACTTAGATAGATCTGTGATCACATATTT
TTGCTGACAACTAGAGGTGACGTAACCAACACAGATGGATTAGAATAAAAAATTAAGTCC
TTTGTTGACAGGCGTAACAAAGCCTTGAAAGAGCAAACTGAGCAAATTGAAAAAAAGGGA
AAATCTGTTTATCTATAAAATTAATAAAATCAATTAGAGCTTCTTGAAAGTACGAATGGT
TCAGTTGACTCTAAACACTCGCACTTCGAAGTAATTTTAGATGAGAACAATGTTGAATAG
AGAATAGAAATTCCAGATAACTTTAACTTCGACTATTCAGAATTATATTTGAATAAAGTA
GTTGAAGACATCAAGTACAATAAAATAACTTCATGTAACATTTGCTTAGAAGATATGGAA
GATGCTGTCTTAACAGCATGTTTGCACGTTTCATGCCGTTTATGCGCAATACGTTCCATT
GAATTCACTGGAATGTGCCCAATTTGCAGAAAATTCATTTCTAAGGAAGACATTATGACT
GTACCGAGAAACAATAGGTTTACTTTTGATCCTACTTAAAAGTACATAAGAAGCTCAAAA
ATAAATGCTGTAATGAATTACATTTAAAACTTATAAAAAACTGATGATAAATGTTTAGTG
TTTACATAATTTTTGGGCATGATGGACTTATTTGAAATAGATTTCCAAAAAAATAAAATT
CCTTATCTAAGACTAGATGGTTCAGTTAATTAAAAATAAAGAGCTGAAATAATTAAAAGA
TTTAACGAAGACAGCTAATACAAAGTTTTCATGATTTCATTAAAGGCAGGAGGTGTAGGT
CTTAATCTAGTGAAAGCAAATCATGTTTTGATGGTAGATCCATGGTGGAATCCAGCAGTG
GAAGAACAAGCAATAGAAAGATGTCATAGAATAGGACAGAAAAAAGAAGTATTTGTTACT
AGATTTATTTGTGATGACTCTATTGAGTCCAGAATGATTAAACTTCATGAAGAAAAAAGA
GACCTCTTTGAAAATACAATACAAGCTACTAAAAAAGATAAAAAAGAATAAAACATAGAG
CACTTTAAATATCTAATGTCAACATATTGA


>TTHERM_00037210(protein)
MNNHIQIEMEYYQSLYDSFVAIVGEGVCTDDEIKKYIQWGNGNLEISLNYYFQQQTKSSG
FQSISQKNQSTSIKNNSSQQNGMKTRQRSQNQQKQQNRDSNNNNQAKLQQAVPQSQKSKA
LNNDLSQQRDTSFQQDEEDKYQEFPKQQTVNAFQKLQEGSKKMREFDKIIEQLKEEYKKP
VQSIVEKKLSVNKDEYSNDFNKDQIYQEHSEDNSFNVNLDYLPSILRRPNPEEAHYESFE
QGIKDVKQSEEQSLQFPCYLGQFILTGHALTSSRCDMKKGDDVILKIERNVQTNIAKNKQ
KAKKSGGQTTQQMIIRLVWREREVGRLDNNYAQVLYPLIDRNYIFIQGQFEYAPPYLQAF
TQIRVSVKVSLLKTCITKPITQIIEENSNTKESQILRIYSETKDQFAQLFEWLNMQMVTP
TLIQVKGKKKNQQINSKERDSIANNRSSFNELNNQNQGQNFQNSLKKETLSDDKGFEEEQ
NEQKKNSSKMLSEDEERESYQNESSDGQKLQEDIFGNLQEAEQDSKRMIAEEESLDISQE
INNILNDQSKSNNNSCNNKYTHQDATSSAPKINLNDPFIKLPKQKTLFSFKLQNKKPDQN
QEQQERSVRQSNNQQVAENKEENKSQDLDYEQLFNIVPGTDGQVTELQYSEPPSTFKTSL
HNYQKQALTWMLSREGKQTDMNEIIKRDTRTLHPLWEKYALPCSLKFFLYFNPYSGQVST
QFPRAQSDCRGGILADEMGLGKTVMMLSLIHSNKRKNHQYIANIKEEDETDLTDDLNNFL
SLKGGNTGQQNQTTITAAFKPKQKNQTLVQMAKKDAGTLIIVPVTLLQQWMDEIQCHSSQ
NSLTYYAYYGNNRENNLNIYDVVITTYGTISSEFASQSNLNNKNLYKFNWHRIVLDEAHY
IKGRVIQIAKAVYSLSGDNRWCMTGTPLQNKLDELFPLIHFIKLEPWSDYIWFNNYINKP
HEKGDLVVYDVLKTILRPILLRRTKKSKDIHGRSIISLPEKHCFIEKVEFTPEERMFYDK
VHQTSKEEFDGFLSQGVLLSNYMKVFELLLRLRQICDHIFLLTTRGDVTNTDGLEQKIKS
FVDRRNKALKEQTEQIEKKGKSVYLQNQQNQLELLESTNGSVDSKHSHFEVILDENNVEQ
RIEIPDNFNFDYSELYLNKVVEDIKYNKITSCNICLEDMEDAVLTACLHVSCRLCAIRSI
EFTGMCPICRKFISKEDIMTVPRNNRFTFDPTQKYIRSSKINAVMNYIQNLQKTDDKCLV
FTQFLGMMDLFEIDFQKNKIPYLRLDGSVNQKQRAEIIKRFNEDSQYKVFMISLKAGGVG
LNLVKANHVLMVDPWWNPAVEEQAIERCHRIGQKKEVFVTRFICDDSIESRMIKLHEEKR
DLFENTIQATKKDKKEQNIEHFKYLMSTY


>TTHERM_00037210(gene)
ATGAATAATCATATATAAATTGAAGTAATAATTAAAGTATTATAATTTCTTAGCATAAGA
GATGAAATTTACTGTATCTAAATATTCATCTTTAGCCAGCTTTTCTATATACAAATCTTC
AACTGCTTTGGTATGCTGAATATGTTTGCCTTTTTGAGGATACTAATTAATCTATATATA
TATATTCTTCTCTTATCTCATAGTAAATTATCTAGATTATTTGTAGACTCTTTACAGATC
AAATTAAAGTAAATTTTACTCAAATGAGAGAAAGATTTTAATCATTCACAAAATAGTAAA
AATTAATTAAAATTTTAGAAACTATTTATTTCTAAAATTATTTTCCACTCTATATAAATA
TTTTTATTTTCAAATATCTTTTTAAAAATCATTTTTTTGAGTAAATAAATATAATTAAAT
GGCAAAAATTTAAAAATCTTTGGAAAATTATTTTTTATTAAATTATTATTGTTTTGGAAT
AATTTAATCATATTCATAATTAGGTTCTTTGTAAAAATTAAAAGTAGTTGAGATCAAAAG
AAAAACTACTAATAATTAAATTAATTTTTATAATAATATTTAAATAGATGAAAACTCTTT
TTCCTCTAAATTAAATAAAATTTATTGGTTTTATTTTATAAATCTCTTCCTTTAAATAAA
TAAAGTCTCTTCTTTTCATTTAACAAAATTTTATAACTTTGGAATATTAAAATAATTCAA
TCAATATAAAGATTAATAAAATACGAATTATTAAATAAATAGATAATATTTTTGAAAGTT
AAAATAATTAATTTTAATATCAATATATTTGATACAAAGAATAAAATATGAATTTTAATG
ATAAAGTTTAATAATTTATATTATTTAGAAACTATATATTTTTAATTAGAAAGTAGGTGC
AATTCAATTCGTTCAGCTTTTTTGATTTTTTGTTTACCTATTTATTTTAATGAAAAGTTT
GTTATATAATTTTATAAGTTTAAATGTAAAATTTATTTAAATAAATAAATAAAAATTAAC
TATTGAATAAAAATCTCTTTCAATAATTTGTTTAAAAATATTTTAACTTTAAAAAAAATT
TACTTGATTATATAATTGTCAACCATGACAAAGTTACTTGATTTTTGATCTAACATAAAC
ACTTAGACAATTTCCTCTTTAGATTAGTTATTTAATATATCATCGTATTTGTTTTTGCTT
TCATTAATAATATTGTTAAATTCTTCCACTAAACCTGATTCATTACTTTTAAGCTTTTCT
AATAAAGTTTTTCTTACTATTTCAAACTCACAATTGAAGTTTTTCAGCAAATTTTTTTTT
TAATTGTTTAGAATATCTTGCTCATCATTTTATTATAAGCTGTTTTAATTATTGACTCTT
GAATTTTAAAATTTTTCACTATTTTTATCTGGCGAATTTCTTTTAATTCTAACATTTTCT
GTCTTTATTTTTTATATTGTTTCTCTATTTTTTTAATATTCCTCACTTAATTAATTTAAT
AGCAAGGTAAGCAACTTTAAGCCTAAATAATTGTTATCATTTTCCTAATAGTTTTTACTG
ATTTAAAATAAGCAATACTTAGATTCGTTAAAGCAGTAAGTAAACAATGTTTCAAGGTCT
TATTAGCTTTACTCCAATTCCTAGAAATGTTTTTCTTAAAAAAAGAAACTTTAATGTTTT
TTGATTTTTTTAATTTCCTCATCAGTCAACTAAGAAATATCTTTATTGTACACTTCATTG
TAGATATCCATAAAATATCTCATCTTTAAATATCTATACTCTGCTAATTCGAAAAAGAAG
AGAAATAACCTCACGCAAGTGCAAAAATATCTGTAATAACGCTGTTTTTCTGACTAGAAT
ACCCAGAAATCAAAGCAATACAATTTCTCAAGTGCAATATAATCTTAACAACATTTGTAA
AATTGGTCTTCTTATTCAACCTTTTGAAACAAGATTTCATTATAATTTGGAATTTCGTAT
ACATCTTTTGAATATACATCTTTTATTTCTTTATTAATTTTATAGAAGTCTTTCTTTATT
TATATATGCGGTTTATAGATTTAAAGATTCAAGCTAATCATTTATATCTCATTCCTTAAA
TAAAAATCCACATTTTCCAAAATATGAGCAATAAAAGCTTCATAGTGATATGAAATTCCT
TCACGAATTTTATTTCTTTCAATTTGTTATGTTTAATTTAAAAATTTAAAAACTCTTTCC
TTTTTTGTATCTGATTATTTAGATAGAAGCTTCTAAACAAAGTTTATTAAGCTGAAATTG
TTTTCTTATAATATTTATCCATTTAAACCTTCAATAAATTTTTTATTACAAGAGTATTTT
TATCAAAATAGTAAAACCAAATATTATCCTCTAAACTCTATATTTAGTCATCAGACTACT
ATCTACTATTACGGTTCATTACTTTTTATAGACTATTTTGTTTAAATATTTATCTTAAAG
TGAGTGATATTCTAAGCAATAATCTAATAATTAACTTCTACCTATTTTAATTAAACAGTA
AGATATTGAATTTGATATTTATAATTCATATCAAAAAAAGCACACAATTTCTTCCACTTA
AACAATATAATTAAAAATATTGATAAAATTTATTTTTTTAATCTTATAACAAATATTTGA
TTAGATAATTCTTTTCGATTCTTTAAATCATATTCTTTTACAGTCTTAAAATGTATAGTA
TTTTATGTTCATATTTAAAAACTATTATAAAATTATAAAATTAAATTTAATTAATATATC
ATTTACAGTTTCCAGTTATCATAGAATTTAAAATTTTTAGATTTTAAAAATTCTAATAAT
TTTTTTTATAAAAATTCTTATAAATAAAAAAATAGAAAATTAAATAGATTCACATTATTT
ATTGAGTGATATTTTGATTGATTTATTGAATTATTAATTTTAAAAAAAATATTTTTTTGA
TTATTTAATTTTTCTTTAAAATAGAATGGATAAATAATAATATAATTAGCTCAAATTTTT
AAAAATAAATTTAAATGATTTCCAAATTTCATTTTATTATTATTAATGTGCCTTATTTTT
CAGCAAAAAAAATTTTCGCTCCAATAAAATTCAATTTTAAATTTTCAATAGACTCTAAAA
TAGAATCTTTTTATGAATATTTATAAAAAGTGAGCCAAAGTAGAGTTTGATTTTAGAATG
TTATTACTCTTCATTGGCTATAGATTAATTAACATTCAAAAGTATTGTTAAAGGCAAAGA
TATTAATTCGTGAATTAAAATCTGAATTCTTATTGAAGTTTATTAGCACTGATTTATTTT
TAAAAAGTAAAAGTATAAACATATCAAAAAATCAAATTAAGACTTAGATTGATTTTTGAT
AGATAATTTTTTTAAGATACTTTTTAAACTAGTATTAAAAACGAAGTAAAACTTTTCATA
GATTTTGCATATCTTTTATTACTCAATAGATGGAATACTATTAAAGTTTATATGACTCTT
TTGTTGCTATTGTAGGAGAAGGTGTTTGCACAGATGATGAAATCAAAAAATATATTTAGT
GGGGCAATGGAAATCTAGAGATATCCTTGAATTATTATTTTTAATAGCAAACAAAAAGCA
GTGGATTTCAATCTATATCTTAAAAAAATTAATCTACTTCCATAAAAAACAATTCTAGCT
AATAAAATGGTATGAAAACAAGGCAAAGAAGGTAAATTATTGATTTAAAAAGAGCACATT
AGGCATTTTCTAGTTGCTTCTATTTTATATTCAAAAATATTTATTTACTGTTTTCTTTAT
TATAAACAGTCAAAACTAGCAAAAACAATAAAATAGAGATAGCAATAATAACAATTAAGC
CAAATTATAATAGGCTGTTCCTCAATCGCAAAAATCAAAAGCTCTCAATAATGATCTCAG
TCAATAAAGGGATACTAGTTTTTAATAAGATGAAGAAGACAAATATTAGGAATTTCCGAA
ACAGTAAACAGTAAATGCATTCTAAAAATTATAAGAAGGAAGCAAAAAAATGAGGGAGTT
TGATAAAATTATTGAGTAGCTCAAAGAAGAGTATAAAAAACCAGTATAATCAATTGTAGA
AAAGAAGCTTTCTGTTAATAAAGATGAGTATAGCAATGATTTTAACAAAGACTAGATCTA
TTAAGAACATAGTGAAGATAATTCTTTCAATGTAAACCTTGATTATTTACCATCTATCTT
GAGACGCCCGAATCCCGAAGAAGCACAGTAAAATTTTGATTTTATTTGAAATAAATAAAT
GTTATTCATTTAAAAAATAAATGATTTGACTTAAACTTAATAAATTTTAGTTTAAATATT
TTAATAATATTAAAGAATTCCTCAAAGTTATACTGCAAAACCTCATATTGATTTTAGTTA
AGTAGAACAGAAAATATATTAACTAGGATAAAATGAATAACTAAATTCAAAAGATACTGA
TAAAAGTGATCTAAGAAATAACTAGCCAATTTTCGAAGACAGAGACATGATGGACAAAAA
TAATTAACAAAATTAAAATAATAATATAAAGCAAGAAGAACCTGAAGAATATAATAACTA
TATAAGCAATTAATAATCAGAATTAGCTTAGCAACAAAACTAATTCTTTTAAGAGAGAAA
TAAGTCTTACTCAGCACAAAGCTTTGATAAGTTAAATATTTCTTAAGTACCTATTAAGGC
TCGCTTTTAATCTGAAACTAATTTAAATGACAATATTTAAGGAATAGAAAATTCAAAAAA
AAAACCTAAAGCTATGAATCGTTTGAATAAGGAATTAAAGATGTTAAGTAAAGTGAAGAA
TAAAGCTTGCAGTTTCCTTGCTACTTGGGACAGTTTATTTTAACAGGGCATGCACTCACT
TCTTCAAGATGTGATATGAAAAAAGGTAAAATTTTATAGAAAAATATTAAATAAAAATTG
AACATAATTATGTTGTTTTTCTAAAATTATATAGGAGATGATGTCATATTAAAAATCGAA
AGAAATGTTTAAACAAATATTGCTAAGAATAAACAAAAAGCTAAAAAAAGTGGGGGTTAA
ACAACTTAGTAAATGATTATTAGGCTTGTTTGGAGAGAAAGAGAAGTTGGAAGGTTAGAT
AATAACTATGCACAAGTTCTCTATCCTTTGATAGATAGAAATTATATATTTATTTAAGGT
TAATTTGAATATGCCCCACCATATCTCTAAGCTTTTACCTAAATCAGAGTATCAGTCAAA
GTGTCTCTACTAAAAACATGTATAACCAAACCAATCACTTAAATTATAGAAGAAAATTCT
AATACAAAGGAAAGTCAAATTCTCAGAATATACAGTGAAACTAAAGATTAATTTGCTCAA
CTCTTTGAGTGGTTAAATATGTAGATGGTAACTCCCACCTTAATTCAAGTGAAGGGTAAG
AAGAAAAATTAACAAATTAATAGTAAAGAAAGAGATTCAATAGCAAATAATAGAAGCAGT
TTTAATGAATTAAATAATTAAAATTAAGGATAAAATTTCCAAAATTCATTAAAAAAAGAA
ACTTTAAGTGATGATAAAGGGTTTGAAGAAGAATAAAATGAACAAAAAAAAAACTCCAGT
AAGATGCTCTCTGAAGATGAAGAAAGAGAGAGCTACTAAAATGAATCTAGTGATGGTTAG
AAACTATAAGAAGATATATTTGGAAACCTACAAGAAGCTGAGTAAGACAGTAAAAGAATG
ATAGCTGAAGAAGAAAGCTTAGATATTTCTTAAGAAATAAACAATATTTTAAATGATTAA
AGCAAGTCAAATAATAATAGTTGTAATAATAAATATACTCATTAAGATGCAACTAGTTCT
GCACCAAAAATTAATTTGAATGACCCATTTATTAAGCTTCCAAAATAGAAAACCCTTTTT
AGCTTCAAATTGTAAAATAAGAAACCAGATTAAAATTAGGAGTAACAAGAAAGATCTGTT
CGTTAAAGCAACAACTAGCAAGTTGCAGAAAACAAAGAAGAAAATAAATCTCAAGACCTA
GATTATGAGCAATTATTTAACATTGTCCCTGGCACAGATGGCTAAGTAACTGAACTTTAA
TACTCAGAGCCACCTTCCACATTTAAAACATCTCTTCACAATTATTAAAAATAAGCTCTA
ACATGGATGCTCTCTCGTGAAGGTAAATAAACTGACATGAATGAAATTATTAAAAGAGAT
ACAAGAACTTTGCACCCTTTATGGGAAAAATATGCTTTGCCTTGCTCATTGAAATTCTTT
TTATATTTTAATCCTTATTCGGGATAAGTCAGTACTTAATTTCCTAGAGCTTAAAGTGAT
TGTAGAGGTGGTATTCTTGCTGATGAAATGGGTTTGGGTAAAACTGTAATGATGCTCAGT
CTTATACATTCCAACAAAAGAAAAAATCACTAATATATTGCAAATATAAAAGAAGAGGAC
GAAACTGATTTAACAGATGATTTAAACAATTTTCTAAGTCTAAAAGGAGGAAATACAGGT
TAACAAAACCAAACCACTATAACAGCCGCATTTAAACCAAAGCAAAAGAACCAAACTCTG
GTTTAAATGGCTAAGAAAGATGCAGGTACTTTAATTATTGTTCCTGTAACTCTCCTTCAA
TAATGGATGGACGAAATTTAATGTCATTCATCACAAAACAGTCTAACCTATTATGCATAT
TATGGAAATAACAGAGAAAATAATTTAAACATTTATGATGTAGTTATCACTACTTACGGA
ACTATTTCGAGTGAATTTGCATCTTAATCAAACTTAAATAATAAAAATCTTTACAAATTT
AATTGGCATAGAATAGTGCTTGATGAAGTAATTTTTTTATTAACATAAAAGTTATTTTAA
ATTCTAATTATAAATCAATTATTTATTTTTTTATTACAGGCTCATTACATAAAAGGGAGA
GTTATATAAATAGCAAAGGCTGTTTACAGTCTTTCAGGTGATAATAGGTGGTGTATGACA
GGAACACCACTACAAAATAAGCTAGATGAGTTGTTTCCTTTAATTCACTTTATCAAACTT
GAACCATGGAGTGATTATATTTGGTTCAATAATTATATAAACAAGGTAAACAATTAAAAG
GAAAACAATTTTTAAAAATTATTATTAAAATTTAGCCTCATGAGAAAGGTGATTTAGTTG
TTTACGATGTCCTTAAAACTATCTTACGTCCTATATTGCTTAGAAGAACCAAAAAGAGCA
AAGATATTCATGGAAGAAGTATTATTAGCCTTCCAGAGAAACATTGCTTCATAGAGAAAG
TTGAGTTCACTCCTGAAGAAAGAATGTTTTATGACAAAGTTCACCAAACTTCCAAAGAAG
AATTTGATGGATTTCTATCTCAAGGCGTCCTTCTTTCTAATTATATGAAAGTATTTAAAA
TTAACAATAGCATTAAAATAAATTCATTTTTAATTGTAAAAGGTGTTCGAGCTTCTATTA
AGACTTAGATAGATCTGTGATCACATATTTTTGCTGACAACTAGAGGTGACGTAACCAAC
ACAGATGGATTAGAATAAAAAATTAAGTCCTTTGTTGACAGGCGTAACAAAGCCTTGAAA
GAGCAAACTGAGCAAATTGAAAAAAAGGGAAAATCTGTTTATCTATAAAATTAATAAAAT
CAATTAGAGCTTCTTGAAAGTACGAATGGTTCAGTTGACTCTAAACACTCGCACTTCGAA
GTAATTTTAGATGAGAACAATGTTGAATAGAGAATAGAAATTCCAGATAACTTTAACTTC
GACTATTCAGAATTATATTTGAATAAAGTAGTTGAAGACATCAAGTACAATAAAATAACT
TCATGTAACATTTGCTTAGAAGATATGGAAGATGCTGTCTTAACAGCATGTTTGCACGTT
TCATGCCGTTTATGCGCAATACGTTCCATTGAATTCACTGGAATGTGCCCAATTTGCAGA
AAATTCATTTCTAAGGAAGACATTATGACTGTACCGAGAAACAATAGGTAAAGAAAATTA
AAAAAATAAAATTATATATTGATAAATCTTAATAATAATAATAATAATTAGGTTTACTTT
TGATCCTACTTAAAAGTACATAAGAAGCTCAAAAATAAATGCTGTAATGAATTACATTTA
AAACTTATAAAAAACTGATGATAAATGTTTAGTGTTTACATAATTTTTGGGCATGATGGA
CTTATTTGAAATAGATTTCCAAAAAAATAAAATTCCTTATCTAGTAAAAATTTATTTAAA
TAAAAAAACATTTATTTATTTCCTAAAAACTAAATAGAGACTAGATGGTTCAGTTAATTA
AAAATAAAGAGCTGAAATAATTAAAAGATTTAACGAAGACAGCTAATACAAAGTTTTCAT
GATTTCATTAAAGGCAGGAGGTGTAGGTCTTAATCTAGTGAAAGCAAATCATGTTTTGAT
GGTAGATCCATGGTGGAATCCAGCAGTGTAATTTAATATTTATTTTGAATAATAATAATA
ATAATAAGAGTAATTTAATTACAAAATAAAGGGAAGAACAAGCAATAGAAAGATGTCATA
GAATAGGACAGAAAAAAGAAGTATTTGTTACTAGATTTATTTGTGATGACTCTATTGAGT
CCAGAATGATTAAACTTCATGAAGAAAAAAGAGACCTCTTTGAAAATACAATACAAGCTA
CTAAAAAAGATAAAAAAGAATAAAACATAGAGCACTTTAAATATCTAATGTCAACATATT
GA