Identifiers and Description

Gene Model Identifier

TTHERM_00825460

Standard Name

RAD4 (RAD4 Ortholog)

Aliases

PreTt04010 | 142.m00107 | 3683.m00040

Description

DNA repair protein Rad4 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03835 ) DNA repair protein Rad4
  • ( PF06696 ) Streptococcal surface antigen repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00825460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18272.19.997093137033517e-262DNA repair protein Rad4 contai
ning protein (932 aa)
OxytrichaContig15291.0.g99.003144504923815e-42Rad4 beta-hairpin domain 3
DictyBaseDDB_G02922961.000116773704384e-19xpc on chromosome: 6 position
1414792 to 1417980
WormBaseWBGene000222961.000361553249356e-16locus:xpc-1 status:Partially
_confirmed UniProt:Q9N4C3
protein_id:CCD73179.1
SGDYER162C0.0000009995106777214876RAD4 Protein that recognizes a
nd binds damaged DNA (with Rad
23p) during nucleotide excisio
n repair; subunit of Nuclear E
xcision Repair Factor 2 (NEF2)
; also involved, with Rad23p,
in turnover of ubiquitylated p
roteins

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000123
  2. Ref:SUPR000122

Sequences

>TTHERM_00825460(coding)
ATGGATTCAAATGAAGATCTTGATTTCAATGATGAATTTGAAGAAGTAGATGAAAAATAA
AATGAAGATAGGATAAGCTTTGGATCTGATGACGAAAATAATTAGTAGAAGTAATCAGAT
TCAGAAGATAATCTCTATTTTGATAATAAAATCAAAAATAATAAAAAATAAAAAAATAAA
TTGGAAGACAGCTATGAAGATGATAGAATGATTAATGAAGATGAAAATTAAGATATCGAT
TTTTTAAATGCCATTTGTAATAAAGATGAAGAAGGTTAAAAAAACATGAGAGAAGACTTT
TTAAGTTTGATTAAAACTGCAGGAGATGATGATACAATTCAGAAATTAATGTAAGAAAGA
CAACAATTAGGTAGAACTGAAGGAGGGAGAGAGAATCCTCATATTATTAAAGAATAAATG
ATTCTTGAGAAAATGCTTGCAAAACAAAAAAGATATGATGAAATTATGTATGAAAAAGAA
AAGCTTGAATTTCTAAAAAAAACTAGAAAGATTCGCTAAAATCCAGAAGAATACAGGAAT
TTTATTAAGTGTTTTGTATTATGCGAAATTTCTTCTACTTTCTACTTTCTATAGTCTCAT
TTGGAAGATGAGTATTTAAAAGCTAAGATAATATCTTAATTTTCTTTAAAAGATTTAAAT
TTTTTACTTTCCATGAAAAACTATCCTGAAAAATACTCAACTAGAAGTATTATAAAAACT
GTTAATTATCACATATAGCAATACTTTACTTATAAATGGAAGAAAGAATAAATTGAATTT
CATAAAAATTTAGATGAAGGAATAGAGGTAGGCTACTCTTAAATGACATTAATTGCCTTG
ATCTTATTTGAATTTATTGGTATGAAAGTTAGATTTTCCAAAATTGTAGACATGAGATAC
CTCAACCTTGACAAAAAACACAATTCAAGGATCAAAGAAAGTAAAAGAAGTTCAAATTAG
TCTTAAGAATCCACACATAGCAATTAAAAGCGTACTAGAGAATCTATAGTAAGTAGTGTT
GTTTAAAATAAGAGAGCTGCACGTTTTTCAGATATGGCTTCTAGAATTACTGCTAAAATA
ATGAATTAGACTTAAATGATAGAAGATTAAATAGATAGTGATTAAAGTGACAGTGATGAT
GAAGATTATTAAACAAAAAAAAATGATAAAAAATAATAATAAAAAGAAAGCAATGATTTA
TTTGACCAAATGCTGTCAAATTTTAAGTTTGATAAAAAAAGCACTAACAATTCATCAATG
ATTAGTTTTAGTAATTAAAAAAAAAATTAACAAGAAGAAGATTCAATTGTTTCAACTGCC
TCATCTACCTTTTAGACTGATCCTAAAAAATTTGATTTTAGAAAGTATTTAAATAAAGGA
AAAAAGCAAGATGATGATAAAAGCTCCTTATTGAAAATAGATAACTAAACATAAAAATAA
GAAGAAGAAGAAATTAAATTAGTTAATAAAAAATTAAGTAATTTGAAGAAGTTAGATAGT
TTATCTGATGTAGAAAAATGCGAAAGCGAAGTTGAAAAAGAAGAGGAAACTTTAAATCCA
TTTAATTTTGCTTTTTCTAAAAAAAAATTTAAAAAGACTTAACAGGACTTAATATAGACT
TAGTAGACAAATTAAACAGAATAGGATTCAAAGCTTTTGGAAAATGACTAAAATTAATAA
CAATAAAAGTTATTAAAAAGTGATTTCTATCAAAGTTCTGAAATAAAGTATTGGCTTGAA
GTTTATGATGAAAAGAGTTAGCAATGGATTTGTTTTGATGCTGTTTAGAATGAAATTTTA
GAAAGATTCTAAATTTTGTTAAAATAAAATAGTATACCTGTTTTATTCATAGTTGGATAT
AATAAATTAGAATTTAAAAATGAAAAATTAAAAGAATATGTTCATAACAAAAGATCTATG
AAAAATTTGTTTTTATTTGATATTACTGATATACACTGTGATAGGTATCCGAAAATTTAG
GTAAGTAGAAGAGAGTTGAATTTCGATTATTGGTGGAAAAATCTTCTTTAACATGTTTCA
TTTCTTGGAAATCCAGAATTACTATAAGACGAATATAAACCCTAAGTAATTAGTGAAAGA
GAAACAAAAATATAAATGTAAAAATCTTAAATCCCTTAATCATATCCTGAGTTTAAAGCA
AGTGAAATTTATATTACTAAGTCAATGCTTTAAAAGTATTAAGGTTTACATCCAAATGCA
TAAAAGACAAATCTTACATTTAAAGACGAAGACGTATATTTTAAAGAATATGTCGTTGAT
TTGCATGCAAAAACTAGATGGAGATCCTACTAAAGATCAGTTAAGCCTGATGAGAAGCCT
GTTAAATAGGTTCAATCGATTTTAGGTAACAAAAAAATGGTAGATTTGTTTGGATTCTGG
TAAACTGAAGAGTTAGTATACAAAATCAGAGATGATGGAACTCTCCCAAGAAATGAATAT
GGTAACTGGGAGACGTTTGCTGGTGATCCACCTGAAGGAACAGTTTTGATTGAAATCTAA
GGATTACCTAAGTTGCTAAAAAAACATAACATAGAGTATGTAGAAGCAGTTTGCGGATTT
GAATCGACAGCATCTGGTAGATCTCATGTGGTTAAAAATGGTATACTAGCCCACAAGAAA
GATGAAGAAAGAATAAGATAAATTTATTAAGATAACTATGAAATTATGAAAGCTCAGTAA
GCAGAAAATCTTAAAAAAGAGCTTATGGGATTTTGGAGAAAAATATTTAAAGGAGTTTTA
CTGAAAAAGAGTATTTCAGATAGATAAAATAAAATAAGTATGTGA


>TTHERM_00825460(protein)
MDSNEDLDFNDEFEEVDEKQNEDRISFGSDDENNQQKQSDSEDNLYFDNKIKNNKKQKNK
LEDSYEDDRMINEDENQDIDFLNAICNKDEEGQKNMREDFLSLIKTAGDDDTIQKLMQER
QQLGRTEGGRENPHIIKEQMILEKMLAKQKRYDEIMYEKEKLEFLKKTRKIRQNPEEYRN
FIKCFVLCEISSTFYFLQSHLEDEYLKAKIISQFSLKDLNFLLSMKNYPEKYSTRSIIKT
VNYHIQQYFTYKWKKEQIEFHKNLDEGIEVGYSQMTLIALILFEFIGMKVRFSKIVDMRY
LNLDKKHNSRIKESKRSSNQSQESTHSNQKRTRESIVSSVVQNKRAARFSDMASRITAKI
MNQTQMIEDQIDSDQSDSDDEDYQTKKNDKKQQQKESNDLFDQMLSNFKFDKKSTNNSSM
ISFSNQKKNQQEEDSIVSTASSTFQTDPKKFDFRKYLNKGKKQDDDKSSLLKIDNQTQKQ
EEEEIKLVNKKLSNLKKLDSLSDVEKCESEVEKEEETLNPFNFAFSKKKFKKTQQDLIQT
QQTNQTEQDSKLLENDQNQQQQKLLKSDFYQSSEIKYWLEVYDEKSQQWICFDAVQNEIL
ERFQILLKQNSIPVLFIVGYNKLEFKNEKLKEYVHNKRSMKNLFLFDITDIHCDRYPKIQ
VSRRELNFDYWWKNLLQHVSFLGNPELLQDEYKPQVISERETKIQMQKSQIPQSYPEFKA
SEIYITKSMLQKYQGLHPNAQKTNLTFKDEDVYFKEYVVDLHAKTRWRSYQRSVKPDEKP
VKQVQSILGNKKMVDLFGFWQTEELVYKIRDDGTLPRNEYGNWETFAGDPPEGTVLIEIQ
GLPKLLKKHNIEYVEAVCGFESTASGRSHVVKNGILAHKKDEERIRQIYQDNYEIMKAQQ
AENLKKELMGFWRKIFKGVLLKKSISDRQNKISM


>TTHERM_00825460(gene)
ATGGATTCAAATGAAGATCTTGATTTCAATGATGAATTTGAAGAAGTAGATGAAAAATAA
AATGAAGATAGGATAAGCTTTGGATCTGATGACGAAAATAATTAGTAGAAGTAATCAGAT
TCAGAAGATAATCTCTATTTTGATAATAAAATCAAAAATAATAAAAAATAAAAAAATAAA
TTGGAAGACAGCTATGAAGATGATAGAATGATTAATGAAGATGAAAATTAAGATATCGAT
TTTTTAAATGCCATTTGTAATAAAGATGAAGAAGGTTAAAAAAACATGAGAGAAGACTTT
TTAAGTTTGATTAAAACTGCAGGAGATGATGATACAATTCAGAAATTAATGTAAGAAAGA
CAACAATTAGGTAGAACTGAAGGAGGGAGAGAGAATCCTCATATTATTAAAGAATAAATG
ATTCTTGAGAAAATGCTTGCAAAACAAAAAAGATATGATGAAATTATGTATGAAAAAGAA
AAGCTTGAATTTCTAAAAAAAACTAGAAAGATTCGCTAAAATCCAGAAGAATACAGGAAT
TTTATTAAGTGTTTTGTATTATGCGAAATTTCTTCTACTTTCTACTTTCTATAGTCTCAT
TTGGAAGATGAGTATTTAAAAGCTAAGATAATATCTTAATTTTCTTTAAAAGATTTAAAT
TTTTTACTTTCCATGAAAAACTATCCTGAAAAATACTCAACTAGAAGTATTATAAAAACT
GTTAATTATCACATATAGCAATACTTTACTTATAAATGGAAGAAAGAATAAATTGAATTT
CATAAAAATTTAGATGAAGGAATAGAGGTAGGCTACTCTTAAATGACATTAATTGCCTTG
ATCTTATTTGAATTTATTGGTATGAAAGTTAGATTTTCCAAAATTGTAGACATGAGATAC
CTCAACCTTGACAAAAAACACAATTCAAGGATCAAAGAAAGTAAAAGAAGTTCAAATTAG
TCTTAAGAATCCACACATAGCAATTAAAAGCGTACTAGAGAATCTATAGTAAGTAGTGTT
GTTTAAAATAAGAGAGCTGCACGTTTTTCAGATATGGCTTCTAGAATTACTGCTAAAATA
ATGAATTAGGTATAATAATTAGTTAAATATTAAAAAAAGGAATATTTATTTAATTTTTAT
AGACTTAAATGATAGAAGATTAAATAGATAGTGATTAAAGTGACAGTGATGATGAAGATT
ATTAAACAAAAAAAAATGATAAAAAATAATAATAAAAAGAAAGCAATGATTTATTTGACC
AAATGCTGTCAAATTTTAAGTTTGATAAAAAAAGCACTAACAATTCATCAATGATTAGTT
TTAGTAATTAAAAAAAAAATTAACAAGAAGAAGATTCAATTGTTTCAACTGCCTCATCTA
CCTTTTAGACTGATCCTAAAAAATTTGATTTTAGAAAGTATTTAAATAAAGGAAAAAAGC
AAGATGATGATAAAAGCTCCTTATTGAAAATAGATAACTAAACATAAAAATAAGAAGAAG
AAGAAATTAAATTAGTTAATAAAAAATTAAGTAATTTGAAGAAGTTAGATAGTTTATCTG
ATGGTAAATTAAAATTAGATAACATTAAATTTATTTTAATAATTAAATTTAATAGTAGAA
AAATGCGAAAGCGAAGTTGAAAAAGAAGAGGAAACTTTAAATCCATTTAATTTTGCTTTT
TCTAAAAAAAAATTTAAAAAGACTTAACAGGGTAGATTTTTAATTATTTTAATTTTAATT
AATTATGTCATTTTTTTAAGACTTAATATAGACTTAGTAGACAAATTAAACAGAATAGGA
TTCAAAGCTTTTGGAAAATGACTAAAATTAATAACAATAAAAGTTATTAAAAAGTGATTT
CTATCAAAGTTCTGAAATAAAGTATTGGCTTGAAGTTTATGATGAAAAGAGTTAGCAATG
GATTTGTTTTGATGCTGTTTAGAATGAAATTTTAGAAAGATTCTAAATTTTGTTAAAATA
AAATAGTATACCTGTTTTATTCATAGTTGGATATAATAAATTAGAATTTAAAAATGAAAA
ATTAAAAGAATATGTTCATAACAAAAGATCTATGAAAAATTTGTTTTTATTTGATATTAC
TGATATACACTGTGATAGGTATCCGAAAATTTAGGTAAGTAGAAGAGAGTTGAATTTCGA
TTATTGGTGGAAAAATCTTCTTTAACATGTTTCATTTCTTGGAAATCCAGAATTACTATA
AGACGAATATGTAAAATGTTATTTATAATAAATTATATTATTTATTATATAAAAAATAGA
AACCCTAAGTAATTAGTGAAAGAGAAACAAAAATATAAATGTAAAAATCTTAAATCCCTT
AATCATATCCTGAGTTTAAAGCAAGTGAAATTTATATTACTAAGTCAATGCTTTAAAAGT
ATTAAGGTTTACATCCAAATGCATAAAAGACAAATCTTACATTTAAAGACGAAGACGTAA
GCAACTATGCTATTAACATTTATTATAATAAATTAATAAAAAAAAGGTATATTTTAAAGA
ATATGTCGTTGATTTGCATGCAAAAACTAGATGGAGATCCTACTAAAGATCAGTTAAGCC
TGATGAGAAGCCTGTTAAATAGGTTCAATCGATTTTAGGTAACAAAAAAATGGTAGATTT
GTTTGGATTCTGGTAAACTGAAGAGTTAGTATACAAAATCAGAGATGATGGAACTCTCCC
AAGAAATGAATATGGTAACTGGGAGGTAATTTTAATTAAAATTATTATAATTTGTTTGTT
TGATTTAAATTAAATAAAAATAAAATTTAATTTAATTAAACTCTCTCTTTAAAATCAAAT
TCTTATTTAGACGTTTGCTGGTGATCCACCTGAAGGAACAGTTTTGATTGAAATCTAAGG
ATTACCTAAGTTGCTAAAAAAACATAACATAGAGTATGTAGAAGCAGTTTGCGGATTTGA
ATCGACAGCATCTGGTAGATCTCATGTGGTTAAAAATGGTATACTAGCCCACAAGAAAGA
TGAAGAAAGAATAAGATAAATTTATTAAGATAACTATGAAATTATGAAAGCTCAGTAAGC
AGAAAATCTTAAAAAAGAGCTTATGGGATTTTGGAGAAAAATATTTAAAGGAGTTTTACT
GAAAAAGAGTATTTCAGATAGATAAAATAAAATAAGTATGTGA