Identifiers and Description

Gene Model Identifier

TTHERM_00586840

Standard Name

RAD3L5 (RADiation sensitive protein family 3-like protein 5)

Aliases

PreTt24096 | 81.m00153 | 3726.m00032

Description

type III restriction enzyme res subunit; Type III restriction enzyme- res subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06733 ) DEAD_2
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08486 ) Stage II sporulation protein
  • ( TIGR00604 ) DNA repair helicase (rad3)
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF04488 ) Glycosyltransferase sugar-binding region containing DXD

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00586840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16927.19.997093137033517e-262hypothetical protein (879 aa)
OxytrichaContig243.0.g1047.000402845995459e-29Helicase C-terminal domain
DictyBaseDDB_G02866216.001696815660978e-24fncJ on chromosome: 4 position
4729555 to 4732791
SGDYPL008W8.998359040303252e-24CHL1 Probable DNA helicase inv
olved in sister-chromatid cohe
sion and genome integrity; int
eracts with ECO1 and CTF18; mu
tants are defective in silenci
ng, rDNA recombination, aging
and the heat shock response; F
ANCJ-like helicase family memb
er
WormBaseWBGene000010499.998720540547892e-23locus:dog-1 status:Partially
_confirmed UniProt:O62217
protein_id:CAB04262.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00586840(coding)
ATGGAACTAGAATTTGCAAAATAGGATGATGAGAAAGATGAAAAATTAAAAAGCCCTAAA
AAAAGTAAACATAAAATAGTTTATGAACAAGAAAAAGAATAAGATAATAATCAATAAATG
GATGCTGAAAAAGATATTTAGCAAAATATACTTGAGATCTGCCTATAAATATTTCCATAT
CCTGAGCCTTATTCAATTTAGATTGAAAGCATGAAAAGTATTATCAAATCTTTGTGTGAG
AAAAAAAATCTGCTATTTTAATCTCCGACAGGCACCGGTAAGACTCTAGTAACTATTTGC
TCTGCTCTTGCTTATGCTATAATAAATCCTAATGTTTAGGTATTTGTTTTAACTAGAACA
AATGAATAAATAAATGGTTTTATTAAAGAAATTAGGAAAATTCGAAATTATGCAGATATT
AGTAGATACTCTATCTTAGCTGGAAGAGGTTCATTTTGCTTGAATATAGATAAAATTAAG
TCACAAATTTAAATGCTAGGTACCAGAAAATCTAAATACAATAAAAATCTTAGTAAGATT
TGCAATTTAATGAAACAAAAATTAAATTGCAATTGTGGAAAGTGCAAAACATCTATAATA
GCAGCTTCTAATGATGATATAGATGAACCTTTTAGTATTTTTTAAAGATATAAATAAGTG
GATATTAATTAGAGATCTAGTTAAAATAAATAAGATTAAGATTAACAGGAAAAAAACTGT
TATATGTGCCCTCATTATAGGATTTACTAATAAATAAAAGAGAAGAAGGAAAAAGAAACT
ATAAAAATGAATTTACACTTCCCATAAGTTCGCTCAGCTTCTGATTAAGCTTATACTTTG
CCTGATATAGAAGATATGAAGAAATTATTTTAGTAAAAAAATTTAGGATGCCCATTTTAT
TTCAACAAGCTAGCAACATAAAATGCTAAATTAGTTTTTTCTACTTATAATTATGTCATT
AAGCAAAATATTCTAGCAAGTATTTAAAATCTTTTTAAAGGTAAAGTTATAGTAATATTT
GATGAAGCACATAATGTTTCTGAGCAAGCTGAATAAGAATAAATTATTAAAATGAGTAAT
AAATATTTTGAATAATTCAATAATACACTTGAAAAGGTTTAAAAAATTTTTTAAAAACCT
CAAAGAAATGAGATGCTTCAAGTAGGTTAAGATATTAGAGCATTGATTTAACTAGATATT
AAATAGGAATCTCTTTTTTTAAAGGAATAACTTCTTAAAAGAGCTGATAAGTAAAAACAA
AATAAAAGTGATATTCAAGATAAAAATGGTGAGGCTGATTATGATAATGATGAAGATGAA
GAAAAATTTTTACAAAAGTACAAACATGCTAAATACAACTCCTATGCAGTTAATACTGAA
TAAAAATTATATAAAAGAAAATTTAATTAGAACATTTTATTTTCCTCTAAAGATTTGTAT
GATTTAGCATTATCAACAATTAATTAAAGTTCTTAAGTTTCGGATGATTCTCCATAATGT
TTATAATAAATATAAAATTACATAAAAGACTCAAATATAAACAAAAGCTAAATAGATGTT
GAAAGTATCTTCAAGCTTTATTAAGAATAAAGAATAAAGGAGGTCTACTATTTTCTTGAT
AATTTTTAAAATCTTTTTTTAACAATTAAAGAAAAATGTGGATTTCTTGAAAAGATATTT
GATTAAAATAATAAATCATAGATTCAACAATTTTGTAAACTCTTTTCTGACAAAGAAATA
GTAAAATAGTTTGAATAACTTAAAGTTAATGATGTTGATTCAGCTTAAAAATTTCTGGGT
AATTTAGAAAAAGTATTTAAAATCATTTTATATATAAAGAAAGTAATAAAAATAAATACT
GAAGAGGATATAGAATAAAAAGATTAATAAAATAAAGATATTTAAGGTGAAAATATCATA
GTAAAAGAAAATAATAATGAAATCTATGAATTAAATATAAATTACAAAAACAATATTAAA
AAACTAGGTGAATAAATTGAAATTAGCTATTTTTCTAAGATTTGGCATTTTTTCTATAAA
TTATTAAAAATGAGAAAATTACATGGTTCTTAAGAAGATCCTCTCTATTTATCTAACCAT
TATATTTCTCTTTTAAGAATAGAAGAATAATAATTCATACCAATCTTACAAATAGGTTGT
CTATCAGCATCATACCTATTTAAAAAAATTTATAAAAAGATCGATATTAGTTCCTTAATA
CTTACTTCAGGTACACTTGAACCATTTGAGTTAATTTAAAAATCTTTAGGTTTAGAATTT
TAAACTTACACATCGCCTCACATAATACATTCATAGTCAAATCTTTTTACCTAATTTATA
AGTTCTTGTGATGGGCAAGATATCTGCTTTAGTATGAATGCACTGAAAAAAGAAAAAAAC
AAAAATAAAATATTTCAAAATTCTCAAATCGTTTTAAATAAAATAATGTCAAAACTTAAT
AGGTATAGTCAACAGGTCAAAGAAAAATGTGGAATAGTCATATTTTTCAAAAGTTATTAA
ATGCTTTAATAATACAAATATATGATAAATATGACAAAAAATGCAGATTTTAAGTTTTTT
GAAGAAAAAAGAGATGCAAATGATTTTAAAATATAATATAGTTCTTATAAGTAATCTATC
TAGTAGAATAAATCTAATTGCATATTCTTGGCTGTTAATAGAGGTAAGCTCTCTGAAGGT
ATAGATCTAAAAGACAATTTATGTAGAGCAGTAATTCTTTTTGGTGTCCCTTATGCAAAT
CTTTCAGACCCTTATATAATATGTAAAAAAACCCATGCTTAGCTTTATTTGGGAGAAAGT
CAATGGTATTAGAAAGATGCAGTTAAAGTAGTCAATTAATCTGCAGGAAGATGCATACGT
TACAAAGATGATTGGGGTTGTATTTTCTTCTTAGATTCTTAATACAGTCTAGAAACAAAT
ATAAATTAACATATTTCTAAATGGATTTTAGAGGGTTAAAGAAAAATTTATAAAGATTCA
GAAGATGAATGGATTGAAGCCTATGATAATTTTTTAGATATGAAGGCTTTAGAGAAAACA
GACTAAGATTAAAGTTGA


>TTHERM_00586840(protein)
MELEFAKQDDEKDEKLKSPKKSKHKIVYEQEKEQDNNQQMDAEKDIQQNILEICLQIFPY
PEPYSIQIESMKSIIKSLCEKKNLLFQSPTGTGKTLVTICSALAYAIINPNVQVFVLTRT
NEQINGFIKEIRKIRNYADISRYSILAGRGSFCLNIDKIKSQIQMLGTRKSKYNKNLSKI
CNLMKQKLNCNCGKCKTSIIAASNDDIDEPFSIFQRYKQVDINQRSSQNKQDQDQQEKNC
YMCPHYRIYQQIKEKKEKETIKMNLHFPQVRSASDQAYTLPDIEDMKKLFQQKNLGCPFY
FNKLATQNAKLVFSTYNYVIKQNILASIQNLFKGKVIVIFDEAHNVSEQAEQEQIIKMSN
KYFEQFNNTLEKVQKIFQKPQRNEMLQVGQDIRALIQLDIKQESLFLKEQLLKRADKQKQ
NKSDIQDKNGEADYDNDEDEEKFLQKYKHAKYNSYAVNTEQKLYKRKFNQNILFSSKDLY
DLALSTINQSSQVSDDSPQCLQQIQNYIKDSNINKSQIDVESIFKLYQEQRIKEVYYFLD
NFQNLFLTIKEKCGFLEKIFDQNNKSQIQQFCKLFSDKEIVKQFEQLKVNDVDSAQKFLG
NLEKVFKIILYIKKVIKINTEEDIEQKDQQNKDIQGENIIVKENNNEIYELNINYKNNIK
KLGEQIEISYFSKIWHFFYKLLKMRKLHGSQEDPLYLSNHYISLLRIEEQQFIPILQIGC
LSASYLFKKIYKKIDISSLILTSGTLEPFELIQKSLGLEFQTYTSPHIIHSQSNLFTQFI
SSCDGQDICFSMNALKKEKNKNKIFQNSQIVLNKIMSKLNRYSQQVKEKCGIVIFFKSYQ
MLQQYKYMINMTKNADFKFFEEKRDANDFKIQYSSYKQSIQQNKSNCIFLAVNRGKLSEG
IDLKDNLCRAVILFGVPYANLSDPYIICKKTHAQLYLGESQWYQKDAVKVVNQSAGRCIR
YKDDWGCIFFLDSQYSLETNINQHISKWILEGQRKIYKDSEDEWIEAYDNFLDMKALEKT
DQDQS


>TTHERM_00586840(gene)
ATGGAACTAGAATTTGCAAAATAGGATGATGAGAAAGATGAAAAATTAAAAAGCCCTAAA
AAAAGTAAACATAAAATAGTTTATGAACAAGAAAAAGAATAAGATAATAATCAATAAATG
GATGCTGAAAAAGATATTTAGCAAAATATACTTGAGATCTGCCTATAAATATTTCCATAT
CCTGAGCCTTATTCAATTTAGATTGAAAGCATGAAAAGTATTATCAAATCTTTGTGTGAG
AAAAAAAATCTGCTATTTTAATCTCCGACAGGCACCGGTAAGACTCTAGTAACTATTTGC
TCTGCTCTTGCTTATGCTATAATAAATCCTAATGTTTAGGTATTTGTTTTAACTAGAACA
AATGAATAAATAAATGGTTTTATTAAAGAAATTAGGAAAATTCGAAATTATGCAGATATT
AGTAGATACTCTATCTTAGCTGGAAGAGGTTCATTTTGCTTGAATATAGATAAAATTAAG
TCACAAATTTAAATGCTAGGTACCAGAAAATCTAAATACAATAAAAATCTTAGTAAGATT
TGCAATTTAATGAAACAAAAATTAAATTGCAATTGTGGAAAGTGCAAAACATCTATAATA
GCAGCTTCTAATGATGATATAGATGAACCTTTTAGTATTTTTTAAAGATATAAATAAGTG
GATATTAATTAGAGATCTAGTTAAAATAAATAAGATTAAGATTAACAGGAAAAAAACTGT
TATATGTGCCCTCATTATAGGATTTACTAATAAATAAAAGAGAAGAAGGAAAAAGAAACT
ATAAAAATGAATTTACACTTCCCATAAGTTCGCTCAGCTTCTGATTAAGCTTATACTTTG
CCTGATATAGAAGATATGAAGAAATTATTTTAGTAAAAAAATTTAGGATGCCCATTTTAT
TTCAACAAGCTAGCAACATAAAATGCTAAATTAGTTTTTTCTACTTATAATTATGTCATT
AAGCAAAATATTCTAGCAAGTATTTAAAATCTTTTTAAAGGTAAAGTTATAGTAATATTT
GATGAAGCACATAATGTTTCTGAGCAAGCTGAATAAGAATAAATTATTAAAATGAGTAAT
AAATATTTTGAATAATTCAATAATACACTTGAAAAGGTTTAAAAAATTTTTTAAAAACCT
CAAAGAAATGAGATGCTTCAAGTAGGTTAAGATATTAGAGCATTGATTTAACTAGATATT
AAATAGGAATCTCTTTTTTTAAAGGAATAACTTCTTAAAAGAGCTGATAAGTAAAAACAA
AGTAAAATTTTAATTTAAATTATTTAATCTTATTTAAAATTTCGAAAAGATAAAAGTGAT
ATTCAAGATAAAAATGGTGAGGCTGATTATGATAATGATGAAGATGAAGAAAAATTTTTA
CAAAAGTACAAACATGCTAAATACAACTCCTATGCAGTTAATACTGAATAAAAATTATAT
AAAAGAAAATTTAATTAGAACATTTTATTTTCCTCTAAAGATTTGTATGATTTAGCATTA
TCAACAATTAATTAAAGTTCTTAAGTTTCGGATGATTCTCCATAATGTTTATAATAAATA
TAAAATTACATAAAAGACTCAAATATAAACAAAAGCTAAATAGATGTTGAAAGTATCTTC
AAGCTTTATTAAGAATAAAGAATAAAGGAGGTCTACTATTTTCTTGATAATTTTTAAAAT
CTTTTTTTAACAATTAAAGAAAAATGTGGATTTCTTGAAAAGATATTTGATTAAAATAAT
AAATCATAGATTCAACAATTTTGTAAACTCTTTTCTGACAAAGAAATAGTAAAATAGTTT
GAATAACTTAAAGTTAATGATGTTGATTCAGCTTAAAAATTTCTGGGTAATTTAGAAAAA
GTATTTAAAATCATTTTATATATAAAGAAAGTAATAAAAATAAATACTGAAGAGGATATA
GAATAAAAAGATTAATAAAATAAAGATATTTAAGGTGAAAATATCATAGTAAAAGAAAAT
AATAATGAAATCTATGAATTAAATATAAATTACAAAAACAATATTAAAAAACTAGGTGAA
TAAATTGAAATTAGCTATTTTTCTAAGATTTGGCATTTTTTCTATAAATTATTAAAAATG
AGAAAATTACATGGTTCTTAAGAAGATCCTCTCTATTTATCTAACCATTATATTTCTCTT
TTAAGAATAGAAGAATAATAATTCATACCAATCTTACAAATAGGTTGTCTATCAGCATCA
TACCTATTTAAAAAAATTTATAAAAAGATCGATATTAGTTCCTTAATACTTACTTCAGGT
ACACTTGAACCATTTGAGTTAATTTAAAAATCTTTAGGTTTAGAATTTTAAACTTACACA
TCGCCTCACATAATACATTCATAGTCAAATCTTTTTACCTAATTTATAAGTTCTTGTGAT
GGGCAAGATATCTGCTTTAGTATGAATGCACTGAAAAAAGAAAAAAACAAAAATAAAATA
TTTCAAAATTCTCAAATCGTTTTAAATAAAATAATGTCAAAACTTAATAGGTATAGTCAA
CAGGTCAAAGAAAAATGTGGAATAGTCATATTTTTCAAAAGTTATTAAATGCTTTAATAA
TACAAATATATGATAAATATGACAAAAAATGCAGATTTTAAGTTTTTTGAAGAAAAAAGA
GATGCAAATGATTTTAAAATATAATATAGTTCTTATAAGTAATCTATCTAGTAGAATAAA
TCTAATTGCATATTCTTGGCTGTTAATAGAGGTAAGCTCTCTGAAGGTATAGATCTAAAA
GACAATTTATGTAGAGCAGTAATTCTTTTTGGTGTCCCTTATGCAAATCTTTCAGACCCT
TATATAATATGTAAAAAAACCCATGCTTAGCTTTATTTGGGAGAAAGTCAATGGTATTAG
AAAGATGCAGTTAAAGTAGTCAATTAATCTGCAGGAAGATGCATACGTTACAAAGATGAT
TGGGGTTGTATTTTCTTCTTAGATTCTTAATACAGTCTAGAAACAAATATAAATTAACAT
ATTTCTAAATGGATTTTAGAGGGTTAAAGAAAAATTTATAAAGATTCAGAAGATGAATGG
ATTGAAGCCTATGATAATTTTTTAGATATGAAGGCTTTAGAGAAAACAGACTAAGATTAA
AGTTGA