Identifiers and Description

Gene Model Identifier

TTHERM_00437617

Standard Name

RAD27 (5' to 3' exonuclease)

Aliases

3708.m00952

Description

flap endonuclease-1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00867 ) XPG I-region
  • ( PF00560 ) Leucine Rich Repeat
  • ( PF00752 ) XPG N-terminal domain
  • ( PF07708 ) Tash protein PEST motif
  • ( PF01367 ) 5'-3' exonuclease, C-terminal SAM fold

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00437617

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12460.19.997093137033517e-262flap endonuclease-1 (387 aa)
OxytrichaContig12777.0.g429.996261361959507e-120XPG I-region
WormBaseWBGene000007945.998625834015334e-112locus:crn-1 Flap endonucleas
e 1 status:Confirmed UniPr
ot:Q9N3T2 protein_id:CCD7255
3.1
SGDYKL113C2.000234809436283e-103RAD27 5 to 3 exonuclease, 5 fl
ap endonuclease, required for
Okazaki fragment processing an
d maturation as well as for lo
ng-patch base-excision repair;
member of the S. pombe RAD2/F
EN1 family
DictyBaseDDB_G02849871.9998944264638884e-101repG on chromosome: 4 position
2762877 to 2764154
Stentor CoeruleusSteCoe_274741.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00437617(protein)
MGIHKLMDLLKEKAPGCIKTSDLKFYAGRMIACDASMAMYQFLATTSSASDFQIQNLTDK
DGNKTGHLVGLLNRTVMLIENGLKPVWVFDGKPPQFKSGELARRQKAKDEAAEKQKTAIE
TGDMQEALKQEQRNLHITKEMKADAIKLLQLVGVPVILAPCEAEAQCAALAKAKKVFATV
TEDMDALTFATPFLLRNLNSKKEPITEINYEKMLQELKLSHNEFVDLCILCGCDYLGRIE
GVGPVNAFKLITEHKSLEKVLEHMEEVNKQSTKKQKYTVPSSYDYVSARDLFINPEVTDP
ETIQLEWKKPDVEELKKFLVEEKGFSEQRVTSQMEKVLNAKEHKGSQTRLNDFFKVQPKD
TSSTSKASKKPTNTKSANKKGGKK


>TTHERM_00437617(coding)
ATGGGAATTCATAAATTGATGGATCTATTAAAGGAGAAAGCTCCTGGATGCATTAAGACA
TCAGATCTAAAATTCTATGCTGGCCGTATGATTGCATGTGATGCCTCTATGGCAATGTAT
TAATTTTTAGCAACTACAAGCAGTGCTTCTGATTTCTAGATATAAAATTTAACAGATAAA
GATGGCAATAAAACAGGACATTTAGTTGGTTTACTTAATAGAACTGTAATGCTTATCGAA
AATGGTCTCAAGCCAGTTTGGGTTTTCGATGGTAAACCTCCTTAATTCAAGAGTGGTGAA
CTTGCAAGAAGACAAAAAGCAAAAGACGAAGCTGCTGAAAAGTAAAAAACTGCTATAGAA
ACTGGTGATATGTAAGAAGCTTTAAAGCAAGAACAACGTAATTTGCATATTACAAAAGAA
ATGAAAGCTGATGCAATAAAATTACTTTAATTGGTTGGTGTTCCAGTGATTTTAGCCCCA
TGTGAAGCAGAAGCATAATGCGCTGCTTTGGCAAAAGCTAAGAAAGTTTTTGCTACTGTT
ACTGAAGATATGGATGCTCTCACTTTTGCTACACCTTTTCTCTTGAGAAATCTCAATAGT
AAAAAGGAACCAATTACAGAAATAAACTACGAAAAGATGCTATAAGAATTAAAGTTATCT
CATAATGAATTTGTTGATTTGTGTATCTTATGTGGATGCGATTATTTAGGACGTATAGAA
GGTGTTGGCCCAGTTAATGCTTTCAAACTTATAACAGAGCACAAATCTCTAGAGAAAGTT
CTTGAACACATGGAAGAAGTTAACAAACAAAGCACTAAAAAATAAAAATATACAGTACCA
AGTTCTTATGATTATGTATCAGCAAGAGATCTTTTTATTAATCCTGAAGTTACTGATCCA
GAGACTATTTAGCTTGAATGGAAGAAACCAGATGTAGAAGAATTAAAGAAATTTTTAGTA
GAAGAAAAAGGATTTAGCGAGTAAAGAGTTACCAGTTAGATGGAAAAAGTTTTAAATGCT
AAAGAACATAAAGGTTCTTAAACCAGACTGAATGATTTCTTTAAAGTATAGCCTAAAGAT
ACATCATCAACAAGTAAGGCATCTAAAAAGCCAACAAATACTAAAAGTGCAAATAAAAAG
GGAGGAAAAAAATGA


>TTHERM_00437617(gene)
ATGGGAATTCATAAATTGATGGATCTATTAAAGGAGAAAGCTCCTGGATGCATTAAGACA
TCAGATCTAAAATTCTATGCTGGCCGTATGATTGCATGTGATGCCTCTATGGTAATCAAT
AACTAATTTAAGCATAATCTAATTATTTTATTCATATTTACTATAAATAGGCAATGTATT
AATTTTTAGCAACTACAAGCAGTGCTTCTGATTTCTAGATATAAAATTTAACAGATAAAG
ATGGCAATAAAACAGGACATTTAGTTGGTTTACTTAATAGAACTGTAATGCTTATCGAAA
ATGGTCTCAAGCCAGTTTGGGTTTTCGATGGTAAACCTCCTTAATTCAAGAGTGGTGAAG
TAATAAATAAATAAACAAATTCATTCAACATTTTTTAAAGATTGAACTTAATGAAATATT
TAAAAATATTTTTTATTTATAAGCTTGCAAGAAGACAAAAAGCAAAAGACGAAGCTGCTG
AAAAGTAAAAAACTGCTATAGAAACTGGTGATATGTAAGAAGCTTTAAAGCAAGAACAAC
GTAATTTGCATATTACAAAAGAAATGAAAGCTGATGCAATAAAATTACTTTAATTGGTTG
GTGTTCCAGTGATTTTAGCCCCATGTGAAGCAGAAGCATAATGCGCTGCTTTGGCAAAAG
CTAAGAAAGTTTTTGCTACTGTTACTGAAGATATGGATGCTCTCACTTTTGCTACACCTT
TTCTCTTGAGAAATCTCAATAGTAAAAAGGAACCAATTACAGAAATAAACTACGAAAAGA
TGCTATAAGAATTAAAGTTATCTCATAATGAATTTGTTGATTTGTGTATCTTATGTGGAT
GCGATTATTTAGGACGTATAGAAGGTGTTGGCCCAGTTAATGCTTTCAAACTTATAACAG
AGCACAAATCTCTAGAGAAAGTTCTTGAACACATGGAAGAAGTTAACAAACAAAGCACTA
AAAAATAAAAATATACAGTACCAAGTTCTTATGATTATGTATCAGCAAGAGATCTTTTTA
TTAATCCTGAAGTTACTGATCCAGAGACTATTTAGGTAAAATTGATCTTTTTTATGTAAA
TATTTATATATAAACTGTGTTTATTTATAAAAAGCTTGAATGGAAGAAACCAGATGTAGA
AGAATTAAAGAAATTTTTAGTAGAAGAAAAAGGATTTAGCGAGTAAAGAGTTACCAGTTA
GATGGAAAAAGTTTTAGTAAAATTATATTTTTTAAATTAAATAAAAATTTATTTTAAATT
AATCATAGAATGCTAAAGAACATAAAGGTTCTTAAACCAGACTGAATGATTTCTTTAAAG
TATAGCCTAAAGATACATCATCAACAAGTAAGGCATCTAAAAAGCCAACAAATACTAAAA
GTGCAAATAAAAAGGGAGGAAAAAAATGA