Identifiers and Description

Gene Model Identifier

TTHERM_00013290

Standard Name

RAD23 (Rad 23 Ortholog)

Aliases

PreTt11835 | 1.m00883

Description

UBA/TS-N domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • proteasome-mediated ubiquitin-dependent protein catabolic process (IEA) | GO:0043161
  • nucleotide-excision repair (IEA) | GO:0006289

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00013290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02723.19.997093137033517e-262UBA/TS-N domain-containing pro
tein (375 aa)
OxytrichaContig21398.0.g835.0019039340728934e-39Ubiquitin family
WormBaseWBGene000139247.001072473260973e-36locus:rad-23 status:Confirme
d UniProt:Q23451 protein_i
d:CAA93780.2
DictyBaseDDB_G02863577.002785992501305e-33rcbA on chromosome: 4 position
4412389 to 4414128
SGDYEL037C4.000352986427571e-28RAD23 Protein with ubiquitin-l
ike N terminus, subunit of Nuc
lear Excision Repair Factor 2
(NEF2) with Rad4p that binds d
amaged DNA; enhances protein d
eglycosylation activity of Png
1p; also involved, with Rad4p,
in ubiquitylated protein turn
over
Stentor CoeruleusSteCoe_243992.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000121
  2. Ref:SUPR000119

Sequences

>TTHERM_00013290(coding)
ATGAAGATCAACATTAAGACTTTAAAGGGCACTGATTTTTTTGATGTTAACCTTGAAGAA
ACTGCTACAGTTGCTGAATTGAAGGAGAAGATTGCTACTGAAAAGTAAAAGGAAAAAGAT
ACTATTAAGTTAGTTCATAAAGGTAAATAATTGACCGAAGACTCTAAGACTCTTGGCGAA
CTTGGTATTAAAGATAATGATTTTGTTATTCTCATGTTCTTTTAAAAGAAAGCAGAAAAA
GAAGATGCTCCATAATAAGCTTAATCTGATACCACTTCTACTACCTCCGCTGCCTCAACA
ACTGCTACTAACCCCACTACTGTTCCTAAGCCTGCTGTTTCCTAACCCGCTACAACATAA
TAAACAGGAAGTTAAGGAACAGGTAGTGATCTCCTTTAAGGTCCTGAATTGGAAGCCAAA
ATTAAAGAAATTGAATCAATGGGTTTTGAAAGACCTAAGGTTCTTTAAGCTTTGAAGGCC
GCTTATTACAATCCTGAAAGAGCAGTTGATTATTTACTCAGTGGTAATATTCCTAAAGAA
CCTAGTTAATAATAGAGTCCTTTACAAGGCTTACAAGGTCCTGGTGTTGAATAATTAGCT
TAATTAGCTTAAAATCCTCAATTCCAACACATTGCTTAAGCTATTCGTTAAAACCCTGCT
CTTCTCCAACCTGTCATGTAATAATTAGCTTAAACTAACCCTGATGTTGCCAGACTTTTA
CAATAAAACCCTCAAGCTTTCTTGCAACTCCTCCTTGCTGCCTCTGAAAACGAAGGTGGA
TAAACCTTACCTCCAAATGCCATCCAAGTCACTCCTGAAGAAAAAGCTGATATTGATGAC
ATTATTTCTATGGGTTTTGATAAAAATGACGCCTTAGAAGCATATATTACCTGCGACAAG
AACAAAGAATTAGCAATTAACTATCTTTTCGAAGCAAGGGAAAGCGGTACTCTTCTTTCT
GAACACATCCAAAAGGAAGAATTAGAAGCTGCATAATAATAATCATAAAACTAAAATTAA
TAACAATAAGGTAATAACCCAAATCAATAATAATAATAAGGTGGATAAGGTGAAGGTGGT
GATAATGATGATGAAGATGACGATGATTTTATGTATTAATGA


>TTHERM_00013290(protein)
MKINIKTLKGTDFFDVNLEETATVAELKEKIATEKQKEKDTIKLVHKGKQLTEDSKTLGE
LGIKDNDFVILMFFQKKAEKEDAPQQAQSDTTSTTSAASTTATNPTTVPKPAVSQPATTQ
QTGSQGTGSDLLQGPELEAKIKEIESMGFERPKVLQALKAAYYNPERAVDYLLSGNIPKE
PSQQQSPLQGLQGPGVEQLAQLAQNPQFQHIAQAIRQNPALLQPVMQQLAQTNPDVARLL
QQNPQAFLQLLLAASENEGGQTLPPNAIQVTPEEKADIDDIISMGFDKNDALEAYITCDK
NKELAINYLFEARESGTLLSEHIQKEELEAAQQQSQNQNQQQQGNNPNQQQQQGGQGEGG
DNDDEDDDDFMYQ


>TTHERM_00013290(gene)
ATGAAGATCAACATTAAGACTTTAAAGGGCACTGATTTTTTTGATGTTAACCTTGAAGAA
ACTGCTACAGTAAATTTATTAAAATGTTTTGTTTTAGGAGAGCTCGAATTCTTGTTGACA
TTTTAAGAATTAGCTAGATAAATACTTGTTTTCAACATATTTTATAATCTTGTTAGGTTG
CTGAATTGAAGGAGAAGATTGCTACTGAAAAGTAAAAGGAAAAAGATACTATTAAGTTAG
TTCATAAAGGTAAATAATTGACCGAAGACTCTAAGACTCTTGGCGAACTTGGTATTAAAG
ATAATGATTTTGTTATTCTCATGTTCTTTTAAAAGGTAATATTATCTTAGTTTTAAGATT
TCTTCAAAATGCGGCTATCTATTTATTTCTCTTTCTATGTGTGCTTTCTTTTAATCATGA
TTAAATTAGAAAAATTCTTCAAAAAATGAAGTAAAATCAATATTTTCTTTGTCGAATTGT
ACACAATTTAATGTGACATGACACTGAAATCATCTTAGTGACTGTTAAGCATTTTAATAG
ATGAATAATAGATAAAGTAGCATAGAAAGCAGAGAAAATTTTATGGCTAGCATTTAATGA
AAGAAAGAAAGAAAGAATGAAATTGCAATTATAATTTAAAAAATAATAAACTAAATATAA
CATTATTATAGAAAGCAGAAAAAGAAGATGCTCCATAATAAGCTTAATCTGATACCACTT
CTACTACCTCCGCTGCCTCAACAACTGCTACTAACCCCACTACTGTTCCTAAGCCTGCTG
TTTCCTAACCCGCTACAACATAATAAACAGGAAGTTAAGGAACAGGTAGTGATCTCCTTT
AAGGTCCTGAATTGGAAGCCAAAATTAAAGAAATTGAATCAATGGGTTTTGAAAGACCTA
AGGTTCTTTAAGCTTTGAAGGCCGCTTATTACAATCCTGAAAGAGCAGTTGATTATTTAC
TCAGTGGTAATATTCCTAAAGAACCTAGTTAATAATAGAGTCCTTTACAAGGCTTACAAG
GTCCTGGTGTTGAATAATTAGCTTAATTAGCTTAAAATCCTCAATTCCAACACATTGCTT
AAGCTATTCGTTAAAACCCTGCTCTTCTCCAACCTGTCATGTAATAATTAGCTTAAACTA
ACCCTGATGTTGCCAGACTTTTACAATAAAACCCTCAAGCTTTCTTGCAACTCCTCCTTG
CTGCCTCTGAAAACGAAGGTGGATAAAGTAATAATTTTAAATTGTTAATTTTTCATGGAC
TTTAAATGCTAAAATAATTGACAAAAGAAAGTCTTTTACTTTTCCATTAAAGACAAAAAG
AATATAAATTCTTGTATCTGTCTTTCTTTCTTTCTATCTATTTATCTTTCTATTGATTGA
TTTAAATAATCTGATCTGATTAAAGAAAATAGAAAAGAGCAGAATTGATTAGTTAGCATA
TCTTCTTCGTTTTTCTATTTATTTTTTAATAAAAATTAATCTTTAAAATTAATTAGCCTT
ACCTCCAAATGCCATCCAAGTCACTCCTGAAGAAAAAGCTGATATTGATGACATTATTTC
TATGGGTTTTGATAAAAATGACGCCTTAGAAGCATATATTACCTGCGACAAGAACAAAGA
ATTAGCAATTAACTATCTTTTCGAAGCAAGGGAAAGCGGTACTCTTCTTTGTAAGAAATA
TTAACTTTTTTTTTTTTAATTCAAGAAAGCAAGCAAGTTTAAAAAAGCAATTGTGTATAT
AAATAAATCATTAAATTAAAATAAGAAATAGTTGAAAAAAAAGATATTCATTCATCCATT
CACATAGTAAATATTCTAAATAAATTTTTATTTAATTAAATAGCTGAACACATCCAAAAG
GAAGAATTAGAAGCTGCATAATAATAATCATAAAACTAAAATTAATAACAATAAGGTAAT
AACCCAAATCAATAATAATAATAAGGTGGATAAGGTGAAGGTGGTGATAATGATGATGAA
GATGACGATGATTTTATGTATTAATGA