Identifiers and Description

Gene Model Identifier

TTHERM_00670390

Standard Name

RAD2 (RADiation sensitive)

Aliases

PreTt01063 | 100.m00124 | 3731.m00034

Description

Similar to yeast Rad2 endonuclease which has a role in nucleotide excision repair; contains XPG (Xeroderma pigmentosum group G protein) domains at both the N and C termini. Similar to yeast YEN1 and human GEN1 resolvase.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07813 ) LTXXQ motif
  • ( PF00867 ) XPG I-region
  • ( PF00752 ) XPG N-terminal domain
  • ( PF04702 ) Vicilin N terminal region
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( TIGR00600 ) DNA excision repair protein (rad2)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00670390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16453.19.997093137033517e-262XPG domain-containing protein
(1109 aa)
OxytrichaContig12596.0.g134.000904604388404e-59XPG I-region
SGDYGR258C2.99915080840225e-45RAD2 Single-stranded DNA endon
uclease, cleaves single-strand
ed DNA during nucleotide excis
ion repair to excise damaged D
NA; subunit of Nucleotide Exci
sion Repair Factor 3 (NEF3); h
omolog of human XPG protein
WormBaseWBGene000190046.002718307283067e-26locus:xpg-1 status:Partially
_confirmed UniProt:O44737
protein_id:CCD71482.1
DictyBaseDDB_G02942907.001446474249442e-19DDB_G0294290 on chromosome: 2
position 10462 to 13395
Stentor CoeruleusSteCoe_49310.0000003059023205018258

General Information

Paragraph NoGene NameParagraph Text
102RAD2Macronuclear knockout did not display a notable vegetative growth or meiotic defect, but was defective in postmeiotic development

Associated Literature

  1. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_00670390(coding)
ATGGGTGTTTAAGGGCTGTGGACTTTGCTCTCTCCAGCAGGCAGAAAATTAAAAGTAGAA
GCTTTAGAAGGTCAGAGATTAGCAATAGATGTTAGTATTTGGGTTATTAGAATGCTTTAC
GGATTTGCAAGTAGAAGAATGAATAGCGAGTTTAAAAATATTCATTTAGTTGGAATATTT
AAGCGTTTATGCAGGCTTTTGAGTTTAGGAATAAAACCTGTATTTGTTTTTGATGGAAAA
GCTCCAGAGTTAAAAAGACATACACTTTATCTTCGTCAATAACAAAGAGAGAAAAGATAA
GTAAACCTTAAAAAATTGGCTGAAAAATATGTAATCAAGTAATTGGAGGGAAAGTTGAAA
GCAGGAAAAAGTTTAGGTAATTAAAATGCAAGTTAAGCTAAAGATTAAGATGATGAAGTT
GATTTCGATGATTTAGATTCGTTAAATAGTGATGAAATGAATGATTTTGAAAAAAATTTA
AATGAATTTTAAATGTCTATTGTTGATGCAGAATTTAAATAAATACTCATTTAAAAAAAG
AAGTATCCTAATCTTTTTGATGGAATTATATCTAATGAGCAGGAATTTTACATTTATGAT
ATAGCATCAAAAGTTGGTATTGTTTAGTAGTTAAATCAACGACTTTAGGAAATTAGAAAT
AGAGATTTATCTAAGATAACTGACATGGAAGAATTTTCTATACTCTAATCAAAAAGTTAT
GTTGAATATGTTACAAGTAAAAAAGAAGTTAGCTAAGTGCGTGATGAAGGTCGCAAAAAT
TTACTAAATTAGCAGTAGAATTTTATGATTAACGAAGCAGCTTCTACAATGAATGAAAAT
CAAAAGAAAAGTTTTTTAAATGATCCTAAAAACAAAATAATTACTGGTTAGTCTAAATCT
GAACATGATAAAATGTTCTTGTTTGTATAAAAAGCTTTTGATACATAGGAAGGAGGAGAA
TAAAATTCCTCAGTAGCAGCAAATAAAATAGGTTTAATTGCAAAACCAGCAAGAAAAACA
AAATTAGAAAGGAAACAAGAAATACAGTCAAGACTCAACGACCTCTTAAAAGCAAGAGAG
TCAAGTACTATTTCTTGGCAAAGATAAATGAAGGAGCAGGAATAAGATGATACTTAAGAG
ACCTCAGAATAATTATAAAATGTATTAAGCAAAATTGAATTTTAAGAAGACGATGATAAC
TTTTTTAATGAACAAAGTATTAATTTTGCAGACTTATGTGCAAACTCAAATAAAAAATAA
AAATAATCGAAAAAAAATGAGGATAGCTCAGATTTGTCTTTTGGAGATAGCTAAAGTTAA
GTTAGTTAGGAAGAAAATAAAGAATAAGAACATGAAGAAAATTTTAATATAAAGTTAAGG
AATGCAAGTTTGAGTGATGACAATATAGGTGAGCTTGATTAAGCAATGATTTAATCTTCT
AGCTAAATTTCAGTTAATGAAGAGTAATCAATTAATATATTGAATGCAATTGAGCTATAA
GATAAAAAAGTTGAGGAAAGTTAAAGAAGCAGCCTAGCAGATACTCAAAAAAGAATATCA
GAAATAGTAAAAAATGACTAAAAGAGTGGTTTTGAAATTTTGTAATAAAAAACTTTGGAA
TAATCTCAGAGACTTGAAGCTAAATAAAAGAATTAAGAATAACACCAGACATAAGAAAAG
CTGTAAGGAAAAGAAGATAATTTTTAAAGTTAATCAGAAGTTAAATAATCACATCTGCTA
GATATGTAAAATAGTAACAAAAAAGTGGATAGTGCTAGAAAAGATGAAACTAATTCATTA
GAATAATTTAAAGTTAATAATTCAAACACAGAAGAAGAAATAGATCAAGTCAAATTTATG
TTTGACAATTAGTAAAAAAAGAGTAATACGACAATGGATGATGAACTCGATATAACCCAT
GCCAAAAAAAAGAAAGAGAGAGAAGATTTAGAAAAACTTATAGAAAAACTAAGAATGGAA
GAAGCTATGAAATAAATGAATGAGCAAGAAAAGAAAAAATTTATTTAAAAGAATCAAAGT
ATATTTTAAAAGACTGAAGAGGAAAATTAAAGTAATGACGAAGACGAAGATGATGAAGAC
CCTGAAGAAATAAAAAAATTGTTAGCTTAAGTTGAAAAATGGGAAGAAGAGTAAAATAAG
CATGTAGATGAAGAAATAGATCTGACAGATGAGTAGCTGGAAGAGGAGTATTAAAGATTT
CTCAATTTAGGTGAATTAGATTCAGAGACAATACAAGATAAATTTTAGTAAGTCAGGTAA
CTGCTTCTACTATTTGGAGTACCATGGGTTGAGGCACCATCTGAAGCAGAAGCTCAATGT
GCATTTTTAGAGTAAATTAAATTAGTTGATGGAATTATTACTGATGATAGTGATGTCTTT
CTCTTTGGAGGAAAAAATATTTATAGAGGATTATTTGGTAAAGAGGCTGATTATGTAAGA
TACATAAATGGTGAAAGTATTGAAAAGGAGATGGGAGTTAATAGAGATAAGCTAATATAC
ATGGCACTCTTTTTAGGTAGTGATTATACACTAGGTATAAAAGGTGTTGGTATAGTTAAT
GCCATGGAAATTTGTACAGCTTTTGAAAATATTGATGCACTAAAGAGATTTAAAGTTTGG
GCAAGTAAGGCAGACGTCTTATTAGAAGATCCTTCTATTCACTACAAAAACATAAGTTTG
AAAGAAAAAAATTATAAAGAACTACATAAAAACTACAAAAAACACTGGGAAATACCAGAA
GAATTTCCTTCCTAAAAAGTTATAAACGCCTATTTAAATCCAAATGTTGACAAATCTGAT
GAGGCATTCTAGTGGGGTAAACCTAGCTTAGGATTATTGAGAGCTTATTGCTAAAATATA
TTTGGGTGGAATGATGAAATAACAAATTACTCACTTAAACCCCTGGAGGAATATTTAAAT
AGAAAGCCTGATCCTCAAAAGAAAATAACTGACTACTATAAATAAGCTTCTAAATTTGCT
ATTATAAACAGTACAAGACTGAAAAATGCAATCAGAGACTTAAAATAAAATGAAACAGGA
GAGCTAGAAAGCAGATTGCAAAATGAGAAGAGAGTTGAAAACATTGTGGAAGGCATAAAT
AATGTATATAAAAACATTTAAGATAAAAAGAGAAAAACTATCAAAAAAGGAGCAATTAAT
ATAGAAATTGAAGAAGAAGATGAAGAAGAAAATGACCAATCTAAACCTTAAGACGAAAAT
GATGACCATATTGATGATGAACCTTTTGATGGAGATCTAAATGGATTTTAATATAATAAA
AAAAATAAAAAAAAAAGATTTTACAAAAAAAATATATTTTGA


>TTHERM_00670390(protein)
MGVQGLWTLLSPAGRKLKVEALEGQRLAIDVSIWVIRMLYGFASRRMNSEFKNIHLVGIF
KRLCRLLSLGIKPVFVFDGKAPELKRHTLYLRQQQREKRQVNLKKLAEKYVIKQLEGKLK
AGKSLGNQNASQAKDQDDEVDFDDLDSLNSDEMNDFEKNLNEFQMSIVDAEFKQILIQKK
KYPNLFDGIISNEQEFYIYDIASKVGIVQQLNQRLQEIRNRDLSKITDMEEFSILQSKSY
VEYVTSKKEVSQVRDEGRKNLLNQQQNFMINEAASTMNENQKKSFLNDPKNKIITGQSKS
EHDKMFLFVQKAFDTQEGGEQNSSVAANKIGLIAKPARKTKLERKQEIQSRLNDLLKARE
SSTISWQRQMKEQEQDDTQETSEQLQNVLSKIEFQEDDDNFFNEQSINFADLCANSNKKQ
KQSKKNEDSSDLSFGDSQSQVSQEENKEQEHEENFNIKLRNASLSDDNIGELDQAMIQSS
SQISVNEEQSINILNAIELQDKKVEESQRSSLADTQKRISEIVKNDQKSGFEILQQKTLE
QSQRLEAKQKNQEQHQTQEKLQGKEDNFQSQSEVKQSHLLDMQNSNKKVDSARKDETNSL
EQFKVNNSNTEEEIDQVKFMFDNQQKKSNTTMDDELDITHAKKKKEREDLEKLIEKLRME
EAMKQMNEQEKKKFIQKNQSIFQKTEEENQSNDEDEDDEDPEEIKKLLAQVEKWEEEQNK
HVDEEIDLTDEQLEEEYQRFLNLGELDSETIQDKFQQVRQLLLLFGVPWVEAPSEAEAQC
AFLEQIKLVDGIITDDSDVFLFGGKNIYRGLFGKEADYVRYINGESIEKEMGVNRDKLIY
MALFLGSDYTLGIKGVGIVNAMEICTAFENIDALKRFKVWASKADVLLEDPSIHYKNISL
KEKNYKELHKNYKKHWEIPEEFPSQKVINAYLNPNVDKSDEAFQWGKPSLGLLRAYCQNI
FGWNDEITNYSLKPLEEYLNRKPDPQKKITDYYKQASKFAIINSTRLKNAIRDLKQNETG
ELESRLQNEKRVENIVEGINNVYKNIQDKKRKTIKKGAINIEIEEEDEEENDQSKPQDEN
DDHIDDEPFDGDLNGFQYNKKNKKKRFYKKNIF


>TTHERM_00670390(gene)
ATGGGTGTTTAAGGGCTGTGGACTTTGCTCTCTCCAGCAGGCAGAAAATTAAAAGTAGAA
GCTTTAGAAGGTCAGAGATTAGCAATAGATGTTAGTATTTGGGTTATTAGAATGCTTTAC
GGATTTGCAAGTAGAAGAATGAATAGCGAGTTTAAAAATATTCATTTAGTTGGAATATTT
AAGCGTTTATGCAGGCTTTTGAGTTTAGGAATAAAACCTGTATTTGTTTTTGATGGAAAA
GCTCCAGAGTTAAAAAGACATACACTTTATCTTCGTCAATAACAAAGAGAGAAAAGATAA
GTAAACCTTAAAAAATTGGCTGAAAAATATGTAATCAAGTAATTGGAGGGAAAGTTGAAA
GCAGGAAAAAGTTTAGGTAATTAAAATGCAAGTTAAGCTAAAGATTAAGATGATGAAGTT
GATTTCGATGATTTAGATTCGTTAAATAGTGATGAAATGAATGATTTTGAAAAAAATTTA
AATGAATTTTAAATGTCTATTGTTGATGCAGAATTTAAATAAATACTCATTTAAAAAAAG
AAGTATCCTAATCTTTTTGATGGAATTATATCTAATGAGCAGGAATTTTACATTTATGAT
ATAGCATCAAAAGTTGGTATTGTTTAGTAGTTAAATCAACGACTTTAGGAAATTAGAAAT
AGAGATTTATCTAAGATAACTGACATGGAAGAATTTTCTATACTCTAATCAAAAAGTTAT
GTTGAATATGTTACAAGTAAAAAAGAAGTTAGCTAAGTGCGTGATGAAGGTCGCAAAAAT
TTACTAAATTAGCAGTAGAATTTTATGATTAACGAAGCAGCTTCTACAATGAATGAAAAT
CAAAAGAAAAGTTTTTTAAATGATCCTAAAAACAAAATAATTACTGGTTAGTCTAAATCT
GAACATGATAAAATGTTCTTGTTTGTATAAAAAGCTTTTGATACATAGGAAGGAGGAGAA
TAAAATTCCTCAGTAGCAGCAAATAAAATAGGTTTAATTGCAAAACCAGCAAGAAAAACA
AAATTAGAAAGGAAACAAGAAATACAGTCAAGACTCAACGACCTCTTAAAAGCAAGAGAG
TCAAGTACTATTTCTTGGCAAAGATAAATGAAGGAGCAGGAATAAGATGATACTTAAGAG
ACCTCAGAATAATTATAAAATGTATTAAGCAAAATTGAATTTTAAGAAGACGATGATAAC
TTTTTTAATGAACAAAGTATTAATTTTGCAGACTTATGTGCAAACTCAAATAAAAAATAA
AAATAATCGAAAAAAAATGAGGATAGCTCAGATTTGTCTTTTGGAGATAGCTAAAGTTAA
GTTAGTTAGGAAGAAAATAAAGAATAAGAACATGAAGAAAATTTTAATATAAAGTTAAGG
AATGCAAGTTTGAGTGATGACAATATAGGTGAGCTTGATTAAGCAATGATTTAATCTTCT
AGCTAAATTTCAGTTAATGAAGAGTAATCAATTAATATATTGAATGCAATTGAGCTATAA
GATAAAAAAGTTGAGGAAAGTTAAAGAAGCAGCCTAGCAGATACTCAAAAAAGAATATCA
GAAATAGTAAAAAATGACTAAAAGAGTGGTTTTGAAATTTTGTAATAAAAAACTTTGGAA
TAATCTCAGAGACTTGAAGCTAAATAAAAGAATTAAGAATAACACCAGACATAAGAAAAG
CTGTAAGGAAAAGAAGATAATTTTTAAAGTTAATCAGAAGTTAAATAATCACATCTGCTA
GATATGTAAAATAGTAACAAAAAAGTGGATAGTGCTAGAAAAGATGAAACTAATTCATTA
GAATAATTTAAAGTTAATAATTCAAACACAGAAGAAGAAATAGATCAAGTCAAATTTATG
TTTGACAATTAGTAAAAAAAGAGTAATACGACAATGGATGATGAACTCGATATAACCCAT
GCCAAAAAAAAGAAAGAGAGAGAAGATTTAGAAAAACTTATAGAAAAACTAAGAATGGAA
GAAGCTATGAAATAAATGAATGAGCAAGAAAAGAAAAAATTTATTTAAAAGAATCAAAGT
ATATTTTAAAAGACTGAAGAGGAAAATTAAAGTAATGACGAAGACGAAGATGATGAAGAC
CCTGAAGAAATAAAAAAATTGTTAGCTTAAGTTGAAAAATGGGAAGAAGAGTAAAATAAG
CATGTAGATGAAGAAATAGATCTGACAGATGAGTAGCTGGAAGAGGAGTATTAAAGATTT
CTCAATTTAGGTGAATTAGATTCAGAGACAATACAAGATAAATTTTAGTAAGTCAGGTAA
CTGCTTCTACTATTTGGAGTACCATGGGTTGAGGTAAGCAAGTTTTTATTTCATTCTAAA
AATAAATAAACTTATTTGTAATTAGGCACCATCTGAAGCAGAAGCTCAATGTGCATTTTT
AGAGTAAATTAAATTAGTTGATGGAATTATTACTGATGATAGTGATGTCTTTCTCTTTGG
AGGAAAAAATATTTATAGAGGATTATTTGGTAAAGAGGCTGATTATGTAAGGTAAAAATT
TAAAGCAATATTAAGAAATTTTTAATAAATAAAAAATATAAAGATACATAAATGGTGAAA
GTATTGAAAAGGAGATGGGAGTTAATAGAGATAAGCTAATATACATGGCACTCTTTTTAG
GTAGTGATTATACACTAGGTATAAAAGGTGTTGGTATAGTTAATGCCATGGAAATTTGTA
CAGCTTTTGAAAATATTGATGCACTAAAGAGATTTAAAGTTTGGGCAAGTAAGGCAGACG
TCTTATTAGAAGATCCTTCTATTCACTACAAAAACATAAGTTTGAAAGAAAAAAATTATA
AAGAACTACATAAAAACTACAAAAAACACTGGGAAATACCAGAAGAATTTCCTTCCTAAA
AAGTTATAAACGCCTATTTAAATCCAAATGTTGACAAATCTGATGAGGCATTCTAGTGGG
GTAAACCTAGCTTAGGATTATTGAGAGCTTATTGCTAAAATATATTTGGGTGGAATGATG
AAATAACAAATTACTCACTTAAACCCCTGGAGGAATATTTAAATAGAAAGCCTGATCCTC
AAAAGAAAATAACTGACTACTATAAATAAGCTTCTAAATTTGCTATTATAAACAGTACAA
GACTGAAAAATGCAATCAGAGACTTAAAATAAAATGAAACAGGAGAGCTAGAAAGCAGAT
TGCAAAATGAGAAGAGAGTTGAAAACATTGTGGAAGGCATAAATAATGTATATAAAAACA
TTTAAGATAAAAAGAGAAAAACTATCAAAAAAGGAGCAATTAATATAGAAATTGAAGAAG
AAGATGAAGAAGAAAATGACCAATCTAAACCTTAAGACGAAAATGATGACCATATTGATG
ATGAACCTTTTGATGGAGATCTAAATGGATTTTAATATAATAAAAAAAATAAAAAAAAAA
GATTTTACAAAAAAAATATATTTTGA