Identifiers and Description

Gene Model Identifier

TTHERM_00420480

Standard Name

RAD16 (helicase and ATPase activities; SNF2 ATPase with E3 Ubiquitin ligase RING domain)

Aliases

PreTt07173 | 46.m00228 | 3679.m00078 | HLTF1

Description

SNF2 family N-terminal domain containing protein with a E3 Ubiquitin Ligase RING domain. Putative homolog to RAD16/RAD5 family of proteins

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF06467 ) MYM-type Zinc finger
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF02891 ) MIZ/SP-RING zinc finger
  • ( PF07196 ) Flagellin hook IN motif
  • ( PF00399 ) Yeast PIR protein repeat
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF02958 ) Domain of unknown function (DUF227)
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07754 ) Domain of unknown function (DUF1610)
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11022.19.997093137033517e-262hypothetical protein (1269 aa)
SGDYLR032W7.000846320060671e-65RAD5 DNA helicase proposed to
promote replication fork regre
ssion during postreplication r
epair by template switching; R
ING finger containing ubiquiti
n ligase; stimulates the synth
esis of free and PCNA-bound po
lyubiquitin chains by Ubc13p-M
ms2p
Stentor CoeruleusSteCoe_196831.6889118802245324e-48
WormBaseWBGene000207425.001052752541194e-37status:Partially_confirmed U
niProt:P91494 protein_id:CCD
70774.1
DictyBaseDDB_G02821152.998577119979921e-31DDB_G0282115 on chromosome: 3
position 5399711 to 5404710
OxytrichaContig21260.0.g599.995528898049344e-31SNF2 family N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420480(coding)
ATGAATTTGAAAGCCAGTTCAGTTAACCTTATAAAAAATGTAATTATTTTATTTATCTTT
GGTATTTACTTAAAAATTTCATTAAAAGTTAAAAGCAATAATCAAAGTGAAAATAACCAT
TTGCATTCTGACCAATACTAGGAAGATGAAACTTATTAAATTCTCACCAACCCATTCTAA
TATTAAATATAAATGAGCAGCTAAAATTATTAAAATTATAACAATAACCCTTCTTATCAG
CCTCTCTAAATAGAATATGCTAATTAGAATTATGATTACTAACTAGAATCATTCTAACAG
GATTGTAATATGACAAATTATTTTTAAACTGAGTAAGATAACAGGAATTAACATTCTCAA
GATCAATTCAGAAATGATTTTAAAAATTAAAATTATTTTGAACCAAACTAATGCGATGTT
GATAATTAAGAATTTAAATTTTAAGTAGATCGTCTTTAATCCTCTGGTGAATTTTTTAAA
TGCTTAGATTTCCTTGCCATAAAAAATTATGATAAATTCTAAGATTAATATCAATATTTA
GGCGCCTTGTAAACGACATTATCTACTGATTTGAAAAAATTCGATTTTATTAACCCTAAT
TAAGTCTACTAAGGAAAGATATAACCTGGAAAGATTTTAAAAATTTCTTGGTAGAATTAC
TCATCAAAAAAATATCTTGATTTTTATGAACTCCACGAAGAAATGAACACACTTGTTTTA
CATAATAACTAATACATTGGGTATATTGATCATACATATTCTTTCATTTGGGGTTACTTG
CTAAATAATAAAATTGTTAACATTTATCCTTATTTTTTCTCGAAAGAAGGCAACAAGATT
CACATACTTTTGGAAGTTTACATTAATCCAAAATTTTTAAAGGCTCCTTTTGACTAAAAT
AATAACTAATAATACAGTTTTAATAAATGTATTAAATATATTGATCAAGTCGCTCTTAAA
ATCTTATTAAATATTTTGAGACTATAAATAACATCTCCCTCTTTAATTGAAAGAGATTTA
TAAAAATATTTTTAAAAATTCAATATATTAAGAAATCAAGTATTTCCAAAAGTATTGATT
TCTTGCAAAAAAACATTTAACTATTATAAAACCTAATTACAAAATTTTCCAAATCATTTT
GTTGATTTTTATTCACAAGTCAATAAAGAAATTGAGATGCTCAAATCTTAAAAGCATTTT
AAATAAATACATTTCACAGAGCCAATATAAGCTAATATTAACTATCCTAGTAAAATGCAA
AATATATACTATTGTAAGAAATAAAACCAAAAAGATTTCATAAAAAATATCAATAATGTA
GTAATTATTTCAGCAGAAAAAAGTAGTTAAGAAGATTCCATAGATAATGAAAATTCTTAT
AGGTTTTATTAGTAAGCTTAATAACCTTCAGATGTCGTTTCGAATCTTCATCCCTATCAA
CTTTAAGGTCTTTAATGGCTTCTTTACAGAGAAAGGAGAGTTGATAATTTATATATTCCT
ACTATGAGAAATTAATTATAAGATTAGAAAACCAAAATCGATATAGATTATGAAGAGATT
GAATTAGTTGGTGGTTAAAAGATTTACAGAAATATTATAAATAACAAATTCTAATATGAA
TTTCCTGAATAATAAGATATATTTGGAGGTATTTTGGCAGATGAAATGGGATTAGGAAAA
ACCCTTACAATTATTTCTTTAATTCACGAAACAAAAAAAGAAAGAACTTCTAAATACGGA
ACCTTAATTATTACACCATCAAATCTAGTGAATTAATGGGAAAATTAATTTAAAAATCAT
TCTAAAGCAGATTCAATTTCTATTCTGAACTTGCAATAAAAAAATAACAGATCTAAAAGT
TTTGAAGATTATGATGTAGTTATTTGTTCATATAACATTATTTGTATGTTATTTGAGAGC
TATGATTTAAGTGATAAAATATTCAATTAATAATGGGAGAGAATTATCCTAGACGAAGCC
CAAAAAATTAAAAATAAACAATCTAAAGTTTCTGAAGCATGTTTCGAAATTTAATCAAAA
TACAAATGGTGCTTAACAGGTACTCCTCTAGAAAACAGCATAGATGATATTTATAGCTTG
ATCCGTTTTTTAAACATACCTAAATACAGTGACTGGAATTGGTGGCGCTAAAATGTAAAA
AATACTAAAAATTAAGAGTAAAAGAGCAACTCTTTCAAAATTATTAACCAAATAATTGAA
AATTTAACTTTGAGAAGGACTAAAAAAAGTTAGTATGCTAACGGTGAAAGTATAACTTCA
ATACCTGAAAAGCAAATTTAAAATATTTATATTGATCTTTTTGACAATGAGAAAAACATC
TACGATAAAATCTTCTAAAAAACTTAGCAAGTCTATAAATTCTTTAAATAAAATTCAAAC
AAAAAAGATAAAAATTATATGCATGTCTTTGAAGTTCTAACTAAGTTGAGAAGGTTCTGT
GTTCACCCTAGTCTTACTTTTAAAATAGAAGAAGAGGCCATTTAAGTAAGCGAAAATAGC
ACTAATGATATTATTTCTAAAATCAACTCATTCTTGAATGAAATTTAATCAAAAATTTAA
TAATAAAATAAAAATAATAAAGAATCTAATTAAAATAATGATGAAAAAAACTAAGAACCA
TAAAATAATATATCTTAATATTAAAAAGAAGTCATTCAGCAAATAAAAGATGGATAATTT
TAAGTTTGTAGTGTTTGCCTTGAAGATATAAAATATCACTCTATAAGTTCTTGTCTTCAC
GTATTTTGCTCATCATGCTTAGAATAAAGTATCCAAACTAATCATAAGTGCCCTCTTTGC
CGTAAACATTTAAGTATGAGCGATATGCTGGATTTTGTTGATGAAGGAGCAGTAATTCAT
TAATAATTGAGTCATTATTTAAATGATGAAATTATCAGTGGATCTAAGATTTAAAAGACT
GTTGAAATCATAGAAGAAATCCATAAAAAGGGAGAAAAAGTTATAGTATTTTCATAATGG
ATAGACACTTTGAATTTATTAGAGAAGCATCTCTAAAAAAAGCAAATTTCTTTTATGAGA
TTCGAAGGTAAATTAACTAAATCTCAAAAGTAAAAGTCTCTATATCATTTTGAAAATCAA
ACAACTAATGCTGACTTGTTACAAGCATCTACTTTAAAAGAAGATAGTAGCTAACAAGAA
TAAACCATGGGATAAGAAGAATAATATGATAATTCTAATTAAAATTAAGAGAATACATCA
TAAACTCCTACTGTACTTTTAGCTTCGCTTATGAGTGGATATGTTGGACTTAACTTGACA
GGAGCTAACAATTTAATATTATGTGATAGCTGGTGGAATCCTGCTGTTGAAGACTAAGCA
ATAAATAGAATTCATAGGTTAGGCTAATAGAAGCAAACTTATATCTATAAAATGATTTGT
AAAGATACAATAGAAGAAAAGATTTAACAAATCAATGATTAAAAAAGAGATATTTTCCAA
ACAATTTTCAATTCTTCTGAACAAAATAAAAATAAAAAAGCAAAAGAATTCTTATAACAG
ATATTGAATTGA


>TTHERM_00420480(protein)
MNLKASSVNLIKNVIILFIFGIYLKISLKVKSNNQSENNHLHSDQYQEDETYQILTNPFQ
YQIQMSSQNYQNYNNNPSYQPLQIEYANQNYDYQLESFQQDCNMTNYFQTEQDNRNQHSQ
DQFRNDFKNQNYFEPNQCDVDNQEFKFQVDRLQSSGEFFKCLDFLAIKNYDKFQDQYQYL
GALQTTLSTDLKKFDFINPNQVYQGKIQPGKILKISWQNYSSKKYLDFYELHEEMNTLVL
HNNQYIGYIDHTYSFIWGYLLNNKIVNIYPYFFSKEGNKIHILLEVYINPKFLKAPFDQN
NNQQYSFNKCIKYIDQVALKILLNILRLQITSPSLIERDLQKYFQKFNILRNQVFPKVLI
SCKKTFNYYKTQLQNFPNHFVDFYSQVNKEIEMLKSQKHFKQIHFTEPIQANINYPSKMQ
NIYYCKKQNQKDFIKNINNVVIISAEKSSQEDSIDNENSYRFYQQAQQPSDVVSNLHPYQ
LQGLQWLLYRERRVDNLYIPTMRNQLQDQKTKIDIDYEEIELVGGQKIYRNIINNKFQYE
FPEQQDIFGGILADEMGLGKTLTIISLIHETKKERTSKYGTLIITPSNLVNQWENQFKNH
SKADSISILNLQQKNNRSKSFEDYDVVICSYNIICMLFESYDLSDKIFNQQWERIILDEA
QKIKNKQSKVSEACFEIQSKYKWCLTGTPLENSIDDIYSLIRFLNIPKYSDWNWWRQNVK
NTKNQEQKSNSFKIINQIIENLTLRRTKKSQYANGESITSIPEKQIQNIYIDLFDNEKNI
YDKIFQKTQQVYKFFKQNSNKKDKNYMHVFEVLTKLRRFCVHPSLTFKIEEEAIQVSENS
TNDIISKINSFLNEIQSKIQQQNKNNKESNQNNDEKNQEPQNNISQYQKEVIQQIKDGQF
QVCSVCLEDIKYHSISSCLHVFCSSCLEQSIQTNHKCPLCRKHLSMSDMLDFVDEGAVIH
QQLSHYLNDEIISGSKIQKTVEIIEEIHKKGEKVIVFSQWIDTLNLLEKHLQKKQISFMR
FEGKLTKSQKQKSLYHFENQTTNADLLQASTLKEDSSQQEQTMGQEEQYDNSNQNQENTS
QTPTVLLASLMSGYVGLNLTGANNLILCDSWWNPAVEDQAINRIHRLGQQKQTYIYKMIC
KDTIEEKIQQINDQKRDIFQTIFNSSEQNKNKKAKEFLQQILN


>TTHERM_00420480(gene)
ATGAATTTGAAAGCCAGTTCAGTTAACCTTATAAAAAATGTAATTATTTTATTTATCTTT
GGTATTTACTTAAAAATTTCATTAAAAGTTAAAAGCAATAATCAAAGTGAAAATAACCAT
TTGCATTCTGACCAATACTAGGAAGATGAAACTTATTAAATTCTCACCAACCCATTCTAA
TATTAAATATAAATGAGCAGCTAAAATTATTAAAATTATAACAATAACCCTTCTTATCAG
CCTCTCTAAATAGAATATGCTAATTAGAATTATGATTACTAACTAGAATCATTGTAAAAT
TTTTTTGAATATTAAATAAATTCTAATTTATTCAATAAAGCTAACAGGATTGTAATATGA
CAAATTATTTTTAAACTGAGTAAGATAAGTAAATATATTTATTTAAATTTTATTTAAAAT
ATTTATTTTTTTTATTTTTCTATTAGCAGGAATTAACATTCTCAAGATCAATTCAGAAAT
GATTTTAAAAATTAAAATTATTTTGAACCAAACTAATGCGATGTTGATAATTAAGAATTT
AAATTTTAAGTAGATCGTCTTTAATCCTCTGGTGAATTTTTTAAATGCTTAGATTTCCTT
GCCATAAAAAATTATGATAAATTCTAAGATTAATATCAATATTTAGGCGCCTTGTAAACG
ACATTATCTACTGATTTGAAAAAATTCGATTTTATTAACCCTAATTAAGTCTACTAAGGA
AAGATATAACCTGGAAAGATTTTAAAAATTTCTTGGTAGAATTACTCATCAAAAAAATAT
CTTGATTTTTATGAACTCCACGAAGAAATGAACACACTTGTTTTACATAATAACTAATAC
GTAATTTATATTTTAATTTTTTAACATTTTTAAAATAATTTATAAATATATTTAGATTGG
GTATATTGATCATACATATTCTTTCATTTGGGGTTACTTGCTAAATAATAAAATTGTTAA
CATTTATCCTTATTTTTTCTCGAAAGAAGGCAACAAGATTCACATACTTTTGGAAGTTTA
CATTAATCCAAAATTTTTAAAGGCTCCTTTTGACTAAAATAATAACTAATAATACAGTTT
TAATAAATGTATTAAATATATTGATCAAGTCGCTCTTAAAATCTTATTAAATATTTTGAG
ACTATAAATAACATCTCCCTCTTTAATTGAAAGAGATTTATAAAAATATTTTTAAAAATT
CAATATATTAAGAAATCAAGTATTTCCAAAAGTATTGATTTCTTGCAAAAAAACATTTAA
CTATTATAAAACCTAATTACAAAATTTTCCAAATCATTTTGTTGATTTTTATTCACAAGT
CAATAAAGAAATTGAGATGCTCAAATCTTAAAAGCATTTTAAATAAATACATTTCACAGA
GCCAATATAAGCTAATATTAACTATCCTAGTAAAATGCAAAATATATACTATTGTAAGAA
ATAAAACCAAAAAGATTTCATAAAAAATATCAATAATGTAGTAATTATTTCAGCAGAAAA
AAGTAGTTAAGAAGATTCCATAGATAATGAAAATTCTTATAGGTTTTATTAGTAAGCTTA
ATAACCTTCAGATGTCGTTTCGAATCTTCATCCCTATCAACTTTAAGGTCTTTAATGGCT
TCTTTACAGAGAAAGGAGAGTTGATAATTTATATATTCCTACTATGAGAAATTAATTATA
AGATTAGAAAACCAAAATCGATATAGATTATGAAGAGATTGAATTAGTTGGTGGTTAAAA
GATTTACAGAAATATTATAAATAACAAATTCTAATATGAATTTCCTGAAGTAAATATTTT
TTTAATAATTAATATAAAACTTAAACACTCATTTTTCAAAGTAATAAGATATATTTGGAG
GTATTTTGGCAGATGAAATGGGATTAGGAAAAACCCTTACAATTATTTCTTTAATTCACG
AAACAAAAAAAGAAAGAACTTCTAAATACGGAACCTTAATTATTACACCATCAAATCTAG
TGAATTAATGGGAAAATTAATTTAAAAATCATTCTAAAGCAGATTCAATTTCTATTCTGA
ACTTGCAATAAAAAAATAACAGATCTAAAAGTTTTGAAGATTATGATGTAGTTATTTGTT
CATATAACATTATTTGTATGTTATTTGAGAGCTATGATTTAAGTGATAAAATATTCAATT
AATAATGGGAGAGAATTATCCTAGACGAAGCCCAAAAAATTAAAAATAAACAATCTAAAG
TTTCTGAAGCATGTTTCGAAATTTAATCAAAATACAAATGGTGCTTAACAGGTACTCCTC
TAGAAAACAGCATAGATGTAAAAATATAATTAAAAATATTTAAATTTTTTTGATCTGTAA
AATTTATTTTATTAAAAAATATTTTTGCAAATAAAAATAGGATATTTATAGCTTGATCCG
TTTTTTAAACATACCTAAATACAGTGACTGGAATTGGTGGCGCTAAAATGTAAAAAATAC
TAAAAATTAAGAGTAAAAGAGCAACTCTTTCAAAATTATTAACCAAATAATTGAAAATTT
AACTTTGAGAAGGACTAAAAAAAGTTAGTATGCTAACGGTGAAAGTATAACTTCAATACC
TGAAAAGCAAATTTAAAATATTTATATTGATCTTTTTGACAATGAGAAAAACATCTACGA
TAAAATCTTCTAAAAAACTTAGCAAGTCTATAAATTCTTTAAATAAAATTCAAACAAAAA
AGATAAAAATTATATGCATGTCTTTGAAGTTCTAACTAAGTTGAGAAGGTTCTGTGTTCA
CCCTAGTCTTACTTTTAAAATAGAAGAAGAGGCCATTTAAGTAAGCGAAAATAGCACTAA
TGATATTATTTCTAAAATCAACTCATTCTTGAATGAAATTTAATCAAAAATTTAATAATA
AAATAAAAATAATAAAGAATCTAATTAAAATAATGATGAAAAAAACTAAGAACCATAAAA
TAATATATCTTAATATTAAAAAGAAGTCATTCAGCAAATAAAAGATGGATAATTTTAAGT
TTGTAGTGTTTGCCTTGAAGATATAAAATATCACTCTATAAGTTCTTGTCTTCACGTATT
TTGCTCATCATGCTTAGAATAAAGTATCCAAACTAATCATAAGTGCCCTCTTTGCCGTAA
ACATTTAAGTATGAGCGATATGCTGGATTTTGTTGATGAAGGAGCAGTAATTCATTAATA
ATTGAGTCATTATTTAAATGATGAAATTATCAGTGGATCTAAGATTTAAAAGACTGTTGA
AATCATAGAAGAAATCCATAAAAAGGGAGAAAAAGTTATAGTATTTTCATAATGGATAGA
CACTTTGAATTTATTAGAGAAGCATCTCTAAAAAAAGCAAATTTCTTTTATGGTAATTAT
TTAAATGATATATTTTTAGATAACCTTTTAATAACTTTTTTTATTTTTTATATTAGAGAT
TCGAAGGTAAATTAACTAAATCTCAAAAGTAAAAGTCTCTATATCATTTTGAAAATCAAA
CAACTAATGCTGACTTGTTACAAGCATCTACTTTAAAAGAAGATAGTAGCTAACAAGAAT
AAACCATGGGATAAGAAGAATAATATGATAATTCTAATTAAAATTAAGAGAATACATCAT
AAACTCCTACTGTACTTTTAGCTTCGCTTATGAGTGGATATGTTGGACTTAACTTGACAG
GAGCTAACAATTTAATATTATGTGATAGCTGGTGGAATCCTGCTGTTGAAGACTAAGCAA
TAAATAGAATTCATAGGTTAGGCTAATAGAAGCAAACTTATATCTATAAAATGATTTGTA
AAGATACAATAGAAGAAAAGATTTAACAAATCAATGATTAAAAAAGAGATATTTTCCAAA
CAATTTTCAATTCTTCTGAACAAAATAAAAATAAAAAAGCAAAAGAATTCTTATAACAGA
TATTGAATTGA