Identifiers and Description

Gene Model Identifier

TTHERM_00011650

Standard Name

RAD10 (RADiation sensitive 10)

Aliases

PreTt11771 | 1.m00819

Description

In yeast, single-stranded DNA endonuclease (with Rad1p), cleaves single-stranded DNA during nucleotide excision repair and double-strand break repair; homolog to yeast RAD10

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00011650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02779.11.0001478224244938e-84mating-type switching protein
swi10 (155 aa)
SGDYML095C0.00000030014504373857585RAD10 Single-stranded DNA endo
nuclease (with Rad1p), cleaves
single-stranded DNA during nu
cleotide excision repair and d
ouble-strand break repair; sub
unit of Nucleotide Excision Re
pair Factor 1 (NEF1); homolog
of human ERCC1 protein
OxytrichaContig1119.1.g1040.000019995566179747357Binding domain of DNA repair p
rotein Ercc1 (rad10/Swi10)
WormBaseWBGene000086651locus:ercc-1 status:Confirme
d UniProt:Q93456 protein_i
d:CAB02283.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000137

Sequences

>TTHERM_00011650(coding)
ATGTTCAAGCCAAAACAAAGAAAACTCTAAATTCTTTAATTTTAGACACAAAATAAGCTT
TTCGATAATATTTCAAAAGAAAGATGGGAAATTACTAAAAATAAAGATTAAGAAGCCGAT
TTCGTTATTGAAGATAGTCCTTACTCATTCATATTTTTATCACTGAAGTATCACACATAA
AATAATATTAAGTATATTGGATAAAAGTTAGAAGCCTTTAAGAAAAACGAAGACTACAAT
AAATACAAAAAAAGAATTCTGCTTCTTCTTTGCGATGTTAATGACGATAAGGATTAAATG
TTTTATCTTCATAAAATGTGTGAGGATTATAATCTAACATTATTATGTGGATTCACTTTC
TAAGAAATAGCTAATTACATATTGACATTTTTATCAGTTTCTAACAATCAACAGCTAGCT
AAGCAATACTTGTAAAACAAAAAGTATTGA


>TTHERM_00011650(protein)
MFKPKQRKLQILQFQTQNKLFDNISKERWEITKNKDQEADFVIEDSPYSFIFLSLKYHTQ
NNIKYIGQKLEAFKKNEDYNKYKKRILLLLCDVNDDKDQMFYLHKMCEDYNLTLLCGFTF
QEIANYILTFLSVSNNQQLAKQYLQNKKY


>TTHERM_00011650(gene)
ATGTTCAAGCCAAAACAAAGAAAACTCTAAATTCTTTAATTTTAGACACAAAATAAGCTT
TTCGATAATATTTCAAAAGAAAGATGGGAAATTACTAAAAATAAAGATTAAGAAGCCGAT
TTCGTTATTGAAGATAGTCCTTACTCATTCATATTTTTATCACTGAAGTATCACACATAA
AATAATATTAAGTATATTGGATAAAAGTTAGAAGCCTTTAAGAAAAACGAAGACTACAAT
AAATACAAAAAAAGAATTCTGCTTCTTCTTTGCGATGTTAATGACGATAAGGATTAAATG
TTTTATCTTCATAAAATGTGTGAGGATTATAATCTAACATTATTATGTGGATTCACTTTC
TAAGAAATAGCTAATTACATATTGACATTTTTATCAGTTTCTAACAATCAACAGCTAGCT
AAGCAATACTTGTAAAACAAAAAGTATTGA