Identifiers and Description

Gene Model Identifier

TTHERM_01113100

Standard Name

RACK1 (Receptor for Activated C Kinase 1)

Aliases

PreTt01916 | 240.m00039

Description

Homolog of yeast ASC1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01113100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19407.19.997093137033517e-262hypothetical protein (345 aa)
OxytrichaContig1225.1.g1071.99970314379378e-94WD domain, G-beta repeat
DictyBaseDDB_G02750459.996373193201036e-79gpbB on chromosome: 2 position
5266629 to 5267764
WormBaseWBGene000105564.001371804839974e-78locus:rack-1 Guanine nucleot
ide-binding protein subunit be
ta-2-like 1 status:Confirmed
UniProt:Q21215 protein_id
:CAA93514.1
SGDYMR116C1.000296925633081e-74ASC1 G-protein beta subunit an
d guanine nucleotide dissociat
ion inhibitor for Gpa2p; ortho
log of RACK1 that inhibits tra
nslation; core component of th
e small (40S) ribosomal subuni
t; represses Gcn4p in the abse
nce of amino acid starvation
Stentor CoeruleusSteCoe_134508.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01113100(coding)
ATGGCTGATAATTCATCTTTAGATATCCAAGTTGTCAAGAGAGGTATCCTCGAAGGTCAC
TCTGACTGGGTCACTTCCATCGTCGCTGGTTTCTCCCAAAAGGAAAACGAAGACTCCCCT
GTCTTGATCTCCGGTTCCAGAGATAAGACCGTCATGATCTGGAAATTGTACGAAGAAGAA
CAAAACGGTTACTTCGGTATCCCCCACAAGGCCCTCACTGGTCACAACCACTTCGTCTCC
GACTTGGCCCTCTCTCAAGAAAACTGCTTCGCCATCTCCTCTTCTTGGGATAAGACCCTC
AGATTGTGGGATTTAAGAACTGGTACCACCTACAAGAGATTCGTTGGTCACCAATCTGAA
GTCTACTCCGTTGCCTTCTCCCCTGATAACAGACAAATTCTCTCCGCTGGTGCCGAAAGA
GAAATCAAGCTCTGGAACATTCTCGGTGAATGCAAGTTCTCCTCTGCTGAAAAGGAAAAC
CACTCTGACTGGGTCTCCTGCGTTAGATACTCCCCCATCATGAAGTCTGCCAACAAGGTT
CAACCCTTCGCTCCTTACTTCGCCTCTGTCGGTTGGGACGGTAGATTGAAGGTCTGGAAC
ACCAACTTCCAAATCAGATACACCTTCAAGGCTCACGAATCCAACGTTAACCACTTATCC
ATCTCCCCCAACGGTAAGTACATCGCCACCGGTGGTAAGGATAAGAAGCTCTTGATCTGG
GATATCCTCAACCTCACCTATCCTCAAAGAGAATTCGACGCTGGTTCCACCATCAACCAA
ATCGCTTTCAACCCCAAGCTCTAATGGGTTGCCGTCGGTACCGACTAAGGTGTCAAGATC
TTCAACCTCATGACTCAATCCAAGGCTCCCGTCTGCACCATTGAAGCTGAACCCATCACC
AAGGCTGAAGGACAAAAGGGTAAGAATCCCCAATGTACCTCTTTGGCTTGGAACGCTTTG
GGTAAGAAATTATTCGCTGGTTTCACCGATGGTGTCATCAGAACTTTCTCTTTCGAAACC
TCTGCTAACTGA


>TTHERM_01113100(protein)
MADNSSLDIQVVKRGILEGHSDWVTSIVAGFSQKENEDSPVLISGSRDKTVMIWKLYEEE
QNGYFGIPHKALTGHNHFVSDLALSQENCFAISSSWDKTLRLWDLRTGTTYKRFVGHQSE
VYSVAFSPDNRQILSAGAEREIKLWNILGECKFSSAEKENHSDWVSCVRYSPIMKSANKV
QPFAPYFASVGWDGRLKVWNTNFQIRYTFKAHESNVNHLSISPNGKYIATGGKDKKLLIW
DILNLTYPQREFDAGSTINQIAFNPKLQWVAVGTDQGVKIFNLMTQSKAPVCTIEAEPIT
KAEGQKGKNPQCTSLAWNALGKKLFAGFTDGVIRTFSFETSAN


>TTHERM_01113100(gene)
ATGGCTGATAATTCATCTTTAGATATCCAAGTTGTCAAGAGAGGTATCCTCGAAGGTCAC
TCTGACTGGGTCACTTCCATCGTCGCTGGTTTCTCCCAAAAGGAAAACGAAGACTCCCCT
GTCTTGATCTCCGGTTCCAGAGATAAGACCGTCATGATCTGGAAATTGTACGAAGAAGAA
CAAAACGGTTACTTCGGTATCCCCCACAAGGCCCTCACTGGTCACAACCACTTCGTCTCC
GACTTGGCCCTCTCTCAAGAAAACTGCTTCGCCATCTCCTCTTCTTGGGATAAGACCCTC
AGATTGTGGGATTTAAGAACTGGTACCACCTACAAGAGATTCGTTGGTCACCAATCTGAA
GTCTACTCCGTTGCCTTCTCCCCTGATAACAGACAAATTCTCTCCGCTGGTGCCGAAAGA
GAAATCAAGCTCTGGAACATTCTCGGTGAATGCAAGTTCTCCTCTGCTGAAAAGGAAAAC
CACTCTGACTGGGTAAGAATATTTACATATTATTATAATAGAGCCAGAAAAAAAAACAAA
ATTTGCGGATATAATTCTAAATTATTTAGCTAGATTCTGACAAAAGTCTAAATAGCATAA
AAATGTGGGATTAATAGAAAATTGTAACACTCTAAGTACAATTACATAAAGGGATTAAAA
TATTTACATATAAGTGCTTTAAAATATAATTTATGATATTTATTTTTGGCAATAATTCAA
AATGTTATACAACTACGAGTAATTAAGGCTCGCTCCCATAATATAAAAACCACACAAATT
AAGAATGAAACTCAATTTTTAGAAGAATGATATACCTAGCTCCTTTTTATAATGGATTTA
GTTTAAAATTTAGAATTATAGGATCTTTTGAGCTTTTTTATGGCATTTAAAAAAATTATA
AATTTGTAAATTAATATTTTACTTACTTTTTTGTTAATATAAATTAGGTCTCCTGCGTTA
GATACTCCCCCATCATGAAGTCTGCCAACAAGGTTCAACCCTTCGCTCCTTACTTCGCCT
CTGTCGGTTGGGACGGTAGATTGAAGGTCTGGAACACCAACTTCCAAATCAGATACACCT
TCAAGGCTCACGAATCCAACGTTAACCACTTATCCATCTCCCCCAACGGTAAGTACATCG
CCACCGGTGGTAAGGATAAGAAGCTCTTGATCTGGGATATCCTCAACCTCACCTATCCTC
AAAGAGAATTCGACGCTGGTTCCACCATCAACCAAATCGCTTTCAACCCCAAGCTCTAAT
GGGTTGCCGTCGGTACCGACTAAGGTGTCAAGATCTTCAACCTCATGACTCAATCCAAGG
CTCCCGTCTGCACCATTGAAGCTGAACCCATCACCAAGGCTGAAGGACAAAGTAAAATAA
ACTTCTTTTTCTTCTTTTCAATTAATTTATTATAGAAATTCAATTATAATTTATTAACTT
AATTTTTATTAATTTACAGAGGGTAAGAATCCCCAATGTACCTCTTTGGCTTGGAACGCT
TTGGGTAAGAAATTATTCGCTGGTTTCACCGATGGTGTCATCAGAACTTTCTCTTTCGAA
ACCTCTGCTAACTGA