Identifiers and Description

Gene Model Identifier

TTHERM_00207240

Standard Name

RABXD1 (Rab-like )

Aliases

PreTt13800 | 17.m00407 | 17.m04083

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00207240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41344.11.000382677035467e-28hypothetical protein (168 aa)
OxytrichaContig22392.0.g297.999528511121947e-28Ras family
WormBaseWBGene000193171.9993007828132465e-27status:Confirmed UniProt:Q21
137 protein_id:CCD72274.1
SGDYOR089C1.9993007828132465e-27VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
DictyBaseDDB_G02721383.999672240330216e-26rab2B on chromosome: 2 positio
n 1483407 to 1484594
Stentor CoeruleusSteCoe_7320.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00207240(coding)
ATGTTTGCTAATTTATCATTAATAAAAAAATAAATTATTTAAAATTAAATTTTTGTGTGG
ATATAATATTAGTATGTATAAAAATTAATTAAATTATTAGATATGTTAGTATTTTTTACA
CATGTATTAAAAGTGCAAAATTAATTAGAAAATTTCATATAATATTAATTAATTAATTAG
TATTTGAAAATCACATTAATTTTATAATAATTTACCTAAATATTTATTTTGCAATAATTA
AAAGTAGTAAAGCCAGCCAGCCACACATTGTATTAAATTAAATTGAAATAAGATAAATAA
ATACTCAGAATGATTCATCATACAAGCTTACCTAAAAATATAAAAGTAGTATAAATTGGA
GACATAAGTGTAGGAAAGAAATCTTTATATTTGAGATATCATTAAGAGTTCAATGGCTAC
CCTAATTAAATATTAGATTTTTACATAAAAACTATTTAGTTAGGAGAGGAACAGATTAAA
TTTTAATTTTGGGATTATTACTCTTACTATAGAGATAGAATATATATTTAAAATTTTTAT
AACTAATGTTTAATAGTTATGATATCTTATGATATTACTAACAGATAATCCTTTGTTGGA
GCTCAATAATGGTTTAAAGATTACAATTAAAAAAAATCAAATAAAGTAGCTGTACTAGCT
TTGATTGGAAATAAATGCGATTTAGAATAATAAAGAAAAGTTTCGTATATAGAAGGTAAA
TAACTTGCAAATTCTTTAGGGATGCTATTTTTCGAAGTCTCCTCTAAAACAGGTTATTAA
GTAAATGAGCTGTTTGAAAGTTTAATAAGCTAAGCGATCAATATATATTGA


>TTHERM_00207240(protein)
MFANLSLIKKQIIQNQIFVWIQYQYVQKLIKLLDMLVFFTHVLKVQNQLENFIQYQLINQ
YLKITLILQQFTQIFILQQLKVVKPASHTLYQIKLKQDKQILRMIHHTSLPKNIKVVQIG
DISVGKKSLYLRYHQEFNGYPNQILDFYIKTIQLGEEQIKFQFWDYYSYYRDRIYIQNFY
NQCLIVMISYDITNRQSFVGAQQWFKDYNQKKSNKVAVLALIGNKCDLEQQRKVSYIEGK
QLANSLGMLFFEVSSKTGYQVNELFESLISQAINIY


>TTHERM_00207240(gene)
ATGTTTGCTAATTTATCATTAATAAAAAAATAAATTATTTAAAATTAAATTTTTGTGTGG
ATATAATATTAGTATGTATAAAAATTAATTAAATTATTAGATATGTTAGTATTTTTTACA
CATGTATTAAAAGTGCAAAATTAATTAGAAAATTTCATATAATATTAATTAATTAATTAG
TATTTGAAAATCACATTAATTTTATAATAATTTACCTAAATATTTATTTTGCAATAATTA
AAAGTAGTAAAGCCAGCCAGCCACACATTGTATTAAATTAAATTGAAATAAGATAAATAA
ATACTCAGAATGATTCATCATACAAGCTTACCTAAAAATATAAAAGTAGTATAAATTGGA
GACATAAGTGTAGGAAAGAAATCTTTATATTTGAGATATCATTAAGAGTTCAATGGCTAC
CCTAATTAAATATTAGATTTTTACATAAAAACTATTTAGTTAGTAAAAATTAATTAATTA
TTCTACAAAATCTAAATAAAAATGTTTGACATTATTTTTAATAGGGAGAGGAACAGATTA
AATTTTAATTTTGGGATTATTACTCTTACTATAGAGATAGAATATATATTTAAAATTTTT
ATAACTAATGTTTAATAGTTATGATATCTTATGATATTACTAACAGATAATCCTTTGTTG
GAGCTCAATAATGGTTTAAAGATTACAATTAAAAAAAATCAAATAAAGTAGCTGTACTAG
CTTTGATTGGAAATAAATGCGATTTAGAATAATAAAGAAAAGTTTCGTATATAGAAGGTA
AATAACTTGCAAATTCTTTAGGGATGCTATTTTTCGAAGTCTCCTCTAAAACAGGTTATT
AAGTAAATGAGCTGTTTGAAAGTTTAATAAGCTAAGCGATCAATATATATTGA