Identifiers and Description

Gene Model Identifier

TTHERM_00823440

Standard Name

RABX35 (Rab-like protein)

Aliases

PreTt20418 | 141.m00075 | 3682.m00009

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00823440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18177.19.997093137033517e-262hypothetical protein (358 aa)
WormBaseWBGene000169700.0000000010002658722841845status:Confirmed UniProt:Q18
898 protein_id:CCD68201.1
OxytrichaContig968.0.g750.0000000020002373268528243Ras family
SGDYML001W0.000000007002490258088747YPT7 Rab family GTPase; GTP-bi
nding protein of the rab famil
y; required for homotypic fusi
on event in vacuole inheritanc
e, for endosome-endosome fusio
n, similar to mammalian Rab7
DictyBaseDDB_G02850510.00000006998394348458725rab32D on chromosome: 4 positi
on 2597422 to 2598751

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00823440(coding)
ATGGTATCTATCCTTTTAAACGACAAACGAATTGGCATTGAGAAGATGTTAGAGGCATAA
CAAATTGCTAAGGAAAAAAAAAGCTAACAAAAAACTTGTTTGTAAAAAAAAATAGAAGAA
AATCAGAGGGAATAGGTTGCTTGTATCGATTGTAAATCTAATCAAAAATTTAATAAATTA
TCAAAACAATAAATTTGCGAAAATAAGAAAACGTAATAAATGTATTCACAAAACGACGTA
GAGAGAAAATGTCTCAAGTAAAAGAAGAAGCTTAAAATTTTGGCAATTGGAGATTCTCAT
ATTGGGAAGACTACTTTCTTAAAGAATTACTGTTCATAGTAGTACGATTTGAATTATAAA
TCCAACGATAATTTTACTTAATAAAAAGTAAATAAAACTATTGGTTGTGATATTCATGTC
TGCTATCATACTCCTAACACCAAAGCTCTTATCACTGAAACAAAATAAAATGATTCACTA
TAATACTAAGAAGAATACACTGTTTAGTTTATAGACATGGCAGGAGAAAATAAATAGAGA
GAGTTTTTGAATGTCTTTATTAGGAATAAACTACAAAAATTAGATGCAATCTTATTCTTT
TTTGATTTGACTAATTTAAATACATTCAAAAACTTTTACAAGTGGCTAATGGCTATATTC
CATAACAGTTAAAGTAAAAAGGACTATGCCTGTGTGTGGTAGATTCCCTTTTTATTGATT
GGGACAAAAACTGATTAAATACCATCTAAATATTAAGCTTAAATAAAATAAAAGTTACTT
AACTAACTAAATAAAATGTTTAAGTGCACACGTGGAGAGAACCTTATCTTTTTAAACGCT
AACAACATTGAAAGCTCAAATTAAAAAGTAGAAATGTCCATGTTCCATTTATTTTTAAGT
GAAATCTGCATTGAAAAGACAATGAAAAATATGAAACAATCAACTAATTCTTCTTTATTT
TCATTTTAAGGTTAAAGTGAATACAATCCATAAGAACTCTTAAGCGGTCTCAACAAAAAC
ACCTAAAAATACTGCTTAAATAATGATAATTATAAGAATAAAAGAATAATTGAAGAAGAT
AAAAACTTTATGCAAATCGTTTTAGAAGTTAATTAATTCTCTGAATATAAAAAAGCTTGG
TAAAATCAAGTTTTTAATTTAACCTCAAGGGTTATTGTTATCAAAGAGCGCATTACTGAA
ATTATTTATACTACTTTTAGAAAAAGCGAAGATGAGCTTGTTCTTCCTCATTCTAATTTA
GAGTGA


>TTHERM_00823440(protein)
MVSILLNDKRIGIEKMLEAQQIAKEKKSQQKTCLQKKIEENQREQVACIDCKSNQKFNKL
SKQQICENKKTQQMYSQNDVERKCLKQKKKLKILAIGDSHIGKTTFLKNYCSQQYDLNYK
SNDNFTQQKVNKTIGCDIHVCYHTPNTKALITETKQNDSLQYQEEYTVQFIDMAGENKQR
EFLNVFIRNKLQKLDAILFFFDLTNLNTFKNFYKWLMAIFHNSQSKKDYACVWQIPFLLI
GTKTDQIPSKYQAQIKQKLLNQLNKMFKCTRGENLIFLNANNIESSNQKVEMSMFHLFLS
EICIEKTMKNMKQSTNSSLFSFQGQSEYNPQELLSGLNKNTQKYCLNNDNYKNKRIIEED
KNFMQIVLEVNQFSEYKKAWQNQVFNLTSRVIVIKERITEIIYTTFRKSEDELVLPHSNL
E


>TTHERM_00823440(gene)
AAAATAGTATTTGTGATTGAAATTAATGATAATATAAGACATTACTTAATTTATTTATTT
AATTATTAGTTAAGTAAAATGGTATCTATCCTTTTAAACGACAAACGAATTGGCATTGAG
AAGATGTTAGAGGCATAACAAATTGCTAAGGAAAAAAAAAGCTAACAAAAAACTTGTTTG
TAAAAAAAAATAGAAGAAAATCAGAGGGAATAGGTTGCTTGTATCGATTGTAAATCTAAT
CAAAAATTTAATAAATTATCAAAACAATAAATTTGCGAAAATAAGAAAACGTAATAAATG
TATTCACAAAACGACGTAGAGAGAAAATGTCTCAAGTAAAAGAAGAAGCTTAAAATTTTG
GCAATTGGAGATTCTCATATTGGGAAGACTACTTTCTTAAAGAATTACTGTTCATAGTAG
TACGATTTGAATTATAAATCCAACGATAATTTTACTTAATAAAAAGTAAATAAAACTATT
GGTTGTGATATTCATGTCTGCTATCATACTCCTAACACCAAAGCTCTTATCACTGAAACA
AAATAAAATGATTCAGTAAAAATTATTTCATTATTTTATACATTTTTTCTTCATAATTTA
TTTCAATCAAACAATAATGAACATAATTTTAAACATTGTTTTTTGATTTTAAACTTTTTA
GCACTTCATGCTTTTTAAATTCCAAATTCATTTTGATAAATTTTTGAGTTTGTAAATGAA
TATTTTAAACGCATCTTTGGAATTTTTTTAGTAAAATTTAAACATTTTTAAGAATCCAAT
TCTCTTAAAACATTTTATGAGCTATTTTTTTTTAGTTAATTCAACAATTTAAAGTTTATT
ATAGTAAAATTAAGTGCAAATTTTAACTATAAAATTAAGTAATATATTTAATAAATTTTT
TTTTGTCTTAAAATAGCTATAATACTAAGAAGAATACACTGTTTAGTTTATAGACATGGC
AGGAGAAAATAAATAGAGAGAGTTTTTGAATGTCTTTATTAGGAATAAACTACAAAAATT
AGATGCAATCTTATTCTTTTTTGATTTGACTAATTTAAATACATTCAAAAACTTTTACAA
GTGGCTAATGGCTATATTCCATAACAGTTAAAGTAAAAAGGACTATGCCTGTGTGTGGTA
GATTCCCTTTTTATTGATTGGGACAAAAACTGATTAAATACCATCTAAATATTAAGCTTA
AATAAAATAAAAGTTACTTAACTAACTAAATAAAATGTTTAAGTGCACACGTGGAGAGAA
CCTTATCTTTTTAAACGCTAACAACATTGAAAGCTCAAATTAAAAAGTAGAAATGTCCAT
GTTCCATTTATTTTTAAGTGAAATCTGCATTGAAAAGACAATGAAAAATATGAAACAATC
AACTAATTCTTCTTTATTTTCATTTTAAGGTTAAAGTGAATACAATCCATAAGAACTCTT
AAGCGGTCTCAACAAAAACACCTAAAAATACTGCTTAAATAATGATAATTATAAGAATAA
AAGAATAATTGAAGAAGATAAAAACTTTATGCAAATCGTTTTAGAAGTTAATTAATTCTC
TGAATATAAAAAAGCTTGGTAAAATCAAGTTTTTAATTTAACCTCAAGGGTTATTGTTAT
CAAAGAGCGCATTACTGAAATTATTTATACTACTTTTAGAAAAAGCGAAGATGAGCTTGT
TCTTCCTCATTCTAATTTAGAGTGA