Identifiers and Description

Gene Model Identifier

TTHERM_00320039

Standard Name

RABX34 (Rab-like protein)

Aliases

32.m02511

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00320039

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41337.14.001033848388204e-30hypothetical protein (182 aa)
DictyBaseDDB_G02922689.996273942859018e-26rab2A on chromosome: 6 positio
n 1422661 to 1423817
OxytrichaContig22591.0.g1129.996273942859018e-26Ras family
WormBaseWBGene000068339.998720540547892e-23locus:unc-108 status:Confirm
ed UniProt:O01577 protein_
id:CCD66422.1
SGDYLR262C9.99946582325553e-18YPT6 Rab family GTPase, Ras-li
ke GTP binding protein involve
d in the secretory pathway, re
quired for fusion of endosome-
derived vesicles with the late
Golgi, maturation of the vacu
olar carboxypeptidase Y; has s
imilarity to the human GTPase,
Rab6

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00320039(protein)
MKEDKPNILKRLIVLGDSNVGKTTLLKSFVFNKEDRQYAFYNIEFHCQVYEKDNQKIKLF
LFDSFGQRSFKFKKNFMIKCNFIVLLYDITNRDSFDSICIQVISQIYKESNPIIILIGNK
CDLESKRQVSFKEGLDIANQYGVFFYEVSALKGIRVDEFINDVLNKIIQIS


>TTHERM_00320039(coding)
ATGAAAGAAGATAAACCTAATATTTTAAAAAGGTTGATAGTTTTAGGAGACTCAAATGTA
GGAAAAACTACTTTACTTAAATCTTTTGTTTTTAACAAAGAAGACAGGTAGTATGCTTTC
TACAATATAGAATTTCATTGTTAAGTTTATGAAAAAGATAATCAAAAAATAAAGCTATTT
TTATTTGATTCATTTGGTTAGCGTAGTTTTAAATTTAAAAAAAATTTTATGATCAAATGT
AATTTTATTGTTTTACTTTATGACATAACTAATAGAGATTCTTTTGATAGTATATGTATT
TAAGTTATAAGCCAAATCTATAAAGAATCTAATCCAATTATTATTTTAATCGGGAACAAA
TGTGATTTAGAATCTAAAAGACAAGTTTCTTTTAAGGAAGGATTAGATATTGCTAATTAA
TATGGAGTTTTTTTTTATGAAGTAAGTGCCTTAAAGGGAATTCGCGTAGATGAATTTATC
AATGATGTATTAAATAAGATAATCTAAATTTCTTGA


>TTHERM_00320039(gene)
ATGAAAGAAGATAAACCTAATATTTTAAAAAGGTTGATAGTTTTAGGAGACTCAAATGTA
GGAAAAACTACTTTACTTAAATCTTTTGTTTTTAACAAAGAAGACAGGTAGTATGCTTTC
TACAATATAGAATTTCATTGTTAAGTTTATGAAAAAGTAAATTTTTTAATATTAATATAA
GTAATTAAATAATATTTTAAAACAGGATAATCAAAAAATAAAGCTATTTTTATTTGATTC
ATTTGGTTAGCGTAGTTTTAAATTTAAAAAAAATTTTATGATCAAATGTAATTTTATTGT
TTTACTTTATGACATAACTAATAGAGATTCTTTTGATAGTATATGTATTTAAGTTATAAG
CCAAATCTATAAAGAATCTAATCCAATTATTATTTTAATCGGGAACAAATGTGATTTAGA
ATCTAAAAGACAAGTTTCTTTTAAGGAAGGATTAGATATTGCTAATTAATATGGAGTTTT
TTTTTATGAAGTAAGTGCCTTAAAGGGAATTCGCGTAGATGAATTTATCAATGATGTATT
AAATAAGATAATCTAAATTTCTTGA