Identifiers and Description

Gene Model Identifier

TTHERM_00497270

Standard Name

RABX33 (Rab-like protein)

Aliases

PreTt06893 | 62.m00177 | 3715.m00038

Description

RABX33 ADP-ribosylation factor family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.2%

TetraMine Data

TTHERM_00497270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12752.13.998261333760679e-157hypothetical protein (214 aa)
OxytrichaContig19016.0.g572.0006398763136557e-76Ras family
Stentor CoeruleusSteCoe_221839.854154686111257e-34
DictyBaseDDB_G02719847.997402223525235e-19rab5A on chromosome: 2 positio
n 1113320 to 1114208
WormBaseWBGene000042663.001003044337619e-17locus:rab-1 status:Confirmed
UniProt:Q9UAQ6 protein_id
:CCD67094.1
SGDYER031C0.000000000000008002679274403579YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497270(coding)
ATGTCTTTATTTTCATAGTAATTCTTGGATTGGTATATATCGAGATTAATGGATAACGAA
GATTATCATTTCAAATTTAGATTTGTTATTTTAGGAGATAAGTCAGTAGGCAAAACTTCA
CTCCTGGAGTCAATAACATAAAATTACGGGAAAATTATGGAATAAGAGCAAAGCGATGAA
TTAAATATGAAGACTGTAGGATACATGGATGTTGATAAGCTTTTCAAAATAGCTTATTGG
GAAATACCAGGATAATAGCGCAATTAAGATTATTTTTATAGGTACTGCTTAGGTGCATCA
GCTGCTATATATATGTTTGATGTTTCAAGAAGGTAAACATTTGAAAGAATAGAAACTTGG
ATTTAAGAGAGTGAAAAATGTGAAATACCCGTTAGAATATTAATTGGAAATAAAGTAGAT
TTATATGCTAATACAAAAGGCGCTGTTTCAAAGAGTGAAGCTGTGGGATTGGCAAAAAAA
TATGGAATGGAATATTTTGAAACATGTTCAATTGGTGATACATCTATTTCCTTAGTTTAT
GATTACTTATTTACTACTATTGTTGATTCTATCCCTAACCCTCCTACTCCTCAATCACTT
GTTGGCAAGGGAATTCTACTTGGTAAAAGACTGCTCAACTCTTCAAAATATTAGTTAGCC
TTGTGTGATATTGCATCTTTATATGAGTGA


>TTHERM_00497270(protein)
MSLFSQQFLDWYISRLMDNEDYHFKFRFVILGDKSVGKTSLLESITQNYGKIMEQEQSDE
LNMKTVGYMDVDKLFKIAYWEIPGQQRNQDYFYRYCLGASAAIYMFDVSRRQTFERIETW
IQESEKCEIPVRILIGNKVDLYANTKGAVSKSEAVGLAKKYGMEYFETCSIGDTSISLVY
DYLFTTIVDSIPNPPTPQSLVGKGILLGKRLLNSSKYQLALCDIASLYE


>TTHERM_00497270(gene)
ATGTCTTTATTTTCATAGTAATTCTTGGTTATTAAATTATTTTTCTTAATTATTTGAAAT
GAGATATAAAAATTTTTGACATTTTAAGGTTTAAAAAGTAATTTCATTTTTTTATTGATA
TAAAACTAATTTTGATTGATAAATATTTTAATAGAATATTTAATTTGGATATAAAATTTA
ATCGGAAATATTCTAAGACAATTTAATTTGATTAATATACTTTTAACATCAGAATATTTA
CTTAAATTGATTAAAAAAGTAAACAAATATTCGATTTAAATATGAATAAAAACATTTTAT
CTCTGAATTTGTTTTTTTGAAAAAAAAATTTTTAACTAAATAGAAGAAATTAATAAATTA
ATTAAAATTGAGCTTTTTAAACAACCAATATTGTTGAAGCTTTATTTATGTTTTTTTATT
ATTTATTATATGGAAATAATTTATTTATATTAAACAACTTATAAAGTTAAAAATATATCT
AATAGAATAAAAAAATATTATAATTAATTAAATAATATAACAAAAAGAAGGTTATTAACT
TAAAAATCAATCAATAATCGTTACCTTTAGCGGTATATAAAAACTTTAATCTAATTAAAT
TTTGATTTAGTTAAAACTGTAATTAAAAAATAGGATTGGTATATATCGAGATTAATGGAT
AACGAAGATTATCATTTCAAATTTAGATTTGTTATTTTAGGTAGATTTAATATTTATTTT
ATTATTAAGTTATTGCACAAGTTAATATTATTTTAATCTATCAATATAACTAATTTAGGA
GATAAGTCAGTAGGCAAAACTTCACTCCTGGAGTGTAATTTAGCTATTATTATATAATTT
AATGATTAATCTCAAATGAATTTATCTTAAAGCAATAACATAAAATTACGGGAAAATTAT
GGAATAAGAGCAAAGCGATGAATTAAATATGAAGGTTTGATACAATTTTATTTTGCTAAT
TTTTGTTTTAGAATATTTGCTACAAAATTTATTATTTATTTATTATTAGACTGTAGGATA
CATGGATGTTGATAAGCTTTTCAAAATAGCTTATTGGGAAATACCAGGATAATAGCGCAA
TTAAGATTATTTTTATAGGTACTGCTTAGGTGCATCAGCTGCTATATATATGTTTGATGG
TGAGCTAAAATATTTTTATTCAGTTTTAGTTATTTTTAAAATGCAAAAATCATAATAGTT
TCAAGAAGGTAAACATTTGAAAGAATAGAAACTTGGATTTAAGAGAGTGAAAAATGTGAA
ATACCCGTTAGAATATTAATTGGAAATAAAGTAAATATCCTAAAAATGCACCTAGTTGAT
TTATATTATAATAAAAAACATTTATTACATAGGTAGATTTATATGCTAATACAAAAGGCG
CTGTTTCAAAGAGTGAAGCTGTGGGATTGGCAAAAAAATATGGAATGGAATATTTTGAAA
CATGGTAAGAATAAGCTTATAAAATAAATCTATTTTTAATAATAATATTTAATTGTAAAT
AGTTCAATTGGTGATACATCTATTTCCTTAGTTTATGATTACTTATTTACTACTATTGTT
GATTCTATCCCTAACCCTCCTACTCCTCAATCACTTGTTGGCAAGGGAATTCTACTTGGT
AAAAGACTGCTCAACTCTTCAAAATATTAGTTAGTATGCATTAATTTGAAATAGCAATCA
AACAAAATATTTTTTATAATAAAAATAGGCCTTGTGTGATATTGCATCTTTATATGAGTG
A