Identifiers and Description

Gene Model Identifier

TTHERM_01085550

Standard Name

RABX32 (Rab-like)

Aliases

PreTt03590 | 226.m00042 | 3799.m00190

Description

RABX32 small guanosine triphosphatase family Ras family protein; Ras family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_01085550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20605.11.9998298245723724e-130Ras family protein (208 aa)
OxytrichaContig9539.0.g567.99612068409928e-70Ras family
Stentor CoeruleusSteCoe_323691.1089390193121365e-40
DictyBaseDDB_G02912353.000842737734004e-34ranA on chromosome: 6 position
78789 to 80092
WormBaseWBGene000043025.999781043483669e-32locus:ran-1 GTP-binding nucl
ear protein ran-1 status:Con
firmed UniProt:O17915 prot
ein_id:CAB07240.1
SGDYML001W4.9985000769285e-31YPT7 Rab family GTPase; GTP-bi
nding protein of the rab famil
y; required for homotypic fusi
on event in vacuole inheritanc
e, for endosome-endosome fusio
n, similar to mammalian Rab7

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01085550(coding)
ATGCATTTCAAGTTAAAAGAAAAAATTAAAAAAAAATTAAAAATATAAAAAATTAAAAAG
CCAATTAAAAAGCTACTTACTTACTTATTTATTTTGAAAATGGATAATAAATCAAAAAAA
CAAGTCAAAGAATATGACGCTAAGGAATTTTCTCCTTGCGATATGAAAGTCATTTTACTA
GGTGACTCAGCAGTTGGAAAATCCAAGCTTGTCGAAAGATTCTTGCTTGATGATTACGAA
GAGAGAAATATGTCAACTTACGCATTAACCATGTATCGTCATGTAGCTAATCTTGATGGA
AAGCAATATAAGATAGATATTTGGGACACTGCAGGCTAAGAATAATTCCAAACTCTTCAT
GCTTCTTATTACTTCCAAGCAAATTGCTGCATTTTAGTTTTTGACATTACAAGAAAAATC
ACCTATTTAAATCTTAAAAAGTGGTACACTGAAATGAGAGAACACTGTCCAGACATCCCT
TGTATATTAATAGCCAATAAGATTGATGCTGATCGTAATGTCACCAACAAGTAGTTTAAG
TTTGCAACCCAACATAACTTACCCTTCTATTTCGTTTCTGCTGCTGATGGAACAAACGTA
GTTAAAATCTTCTAAGAAGCCCTTAGATTAGCTTTAGATAATAAGATCAATCCTCCCAAT
AAAGATGATAAATTTTTCGAGGATCTTATAAATGATAAAGACTTGTTCGATGACTTAGAT
GATTGA


>TTHERM_01085550(protein)
MHFKLKEKIKKKLKIQKIKKPIKKLLTYLFILKMDNKSKKQVKEYDAKEFSPCDMKVILL
GDSAVGKSKLVERFLLDDYEERNMSTYALTMYRHVANLDGKQYKIDIWDTAGQEQFQTLH
ASYYFQANCCILVFDITRKITYLNLKKWYTEMREHCPDIPCILIANKIDADRNVTNKQFK
FATQHNLPFYFVSAADGTNVVKIFQEALRLALDNKINPPNKDDKFFEDLINDKDLFDDLD
D


>TTHERM_01085550(gene)
ATGCATTTCAAGTTAAAAGAAAAAATTAAAAAAAAATTAAAAATATAAAAAATTAAAAAG
CCAATTAAAAAGCTACTTACTTACTTATTTATTTTGAAAATGGATAATAAATCAAAAAAA
CAAGTCAAAGAATATGACGCTAAGGAATTTTCTCCTTGCGATATGAAAGTCATTTTACTA
GGTGACTCAGCAGTTGGAAAATCCAAGTAACTAGCCTTTTAAATTGATATTTTTTACTTA
AGAGTCTAAATTTAGATTCAATTTATTTAATACTAATTGCTTTTAACATCAACAATTATT
TTATAAAATAGGCTTGTCGAAAGATTCTTGCTTGATGATTAGTAATTGATTTTTTTAAAT
AAACCATCTTGCATTTTACTTATTGTTAAAGCTTCTAAAATCTATTTTTTTAACTATTAG
CGAAGAGAGAAATATGTCAACTTACGCATTAACCATGTATCGTCATGTAGCTAATCTTGA
TGGAAAGCAATATAAGATAGGTAAATTGCATTAAAAATACATTAGAATTTTCTTTGTTTT
TTATCATTTTTAGATTGTGTAATACTTTTTTAACTTTTACTTGTTTTAAACAGATATTTG
GGACACTGCAGGCTAAGAATAATTCCAAACTCTTCATGCTTCTTATTACTTCCAAGCAAA
TTGCTGCATTTTAGTTTTTGACATTACAAGAAAAATCACCTATTTAAATCTTAAAAAGTG
GTACACTGAAATGAGAGAACACTGTCCAGACATCCCTTGTATATTAATAGCCAATAAGAT
TGATGGTATTTAATTATTAGTTTTCATATTAATTTAAGCTAACCAAAATAGATTTAAATA
ACCAATTTAATAAATAAATATAGCTGATCGTAATGTCACCAACAAGTAGTTTAAGTTTGC
AACCCAACATAACTTACCCTTCTATTTCGTTTCTGCTGCTGATGGAACAAACGTAGTTAA
AATCTTCTAAGAAGCCCTTAGATTAGCTTTAGATAATAAGATCAATCCTCCCAATAAAGA
TGATAAATTTTTCGAGGATCTTATAAATGATGTAAAGATTCAAATAGAATTAAATAAATT
TAATTTTAATTTATTTTACTTCGATAAAATTAGAAAGACTTGTTCGATGACTTAGATGAT
TGA