Identifiers and Description

Gene Model Identifier

TTHERM_01085550

Standard Name

RABX32 (Rab-like)

Aliases

PreTt03590 | 226.m00042 | 3799.m00190

Description

Ras family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01085550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20605.11.9998298245723724e-130Ras family protein (208 aa)
OxytrichaContig9539.0.g567.99612068409928e-70Ras family
Stentor CoeruleusSteCoe_323691.1089390193121365e-40
DictyBaseDDB_G02912353.000842737734004e-34ranA on chromosome: 6 position
78789 to 80092
WormBaseWBGene000043025.999781043483669e-32locus:ran-1 GTP-binding nucl
ear protein ran-1 status:Con
firmed UniProt:O17915 prot
ein_id:CAB07240.1
SGDYML001W4.9985000769285e-31YPT7 Rab family GTPase; GTP-bi
nding protein of the rab famil
y; required for homotypic fusi
on event in vacuole inheritanc
e, for endosome-endosome fusio
n, similar to mammalian Rab7

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01085550(coding)
ATGCATTTCAAGTTAAAAGAAAAAATTAAAAAAAAATTAAAAATATAAAAAATTAAAAAG
CCAATTAAAAAGCTACTTACTTACTTATTTATTTTGAAAATGGATAATAAATCAAAAAAA
CAAGTCAAAGAATATGACGCTAAGGAATTTTCTCCTTGCGATATGAAAGTCATTTTACTA
GGTGACTCAGCAGTTGGAAAATCCAAGCTTGTCGAAAGATTCTTGCTTGATGATTACGAA
GAGAGAAATATGTCAACTTACGCATTAACCATGTATCGTCATGTAGCTAATCTTGATGGA
AAGCAATATAAGATAGATATTTGGGACACTGCAGGCTAAGAATAATTCCAAACTCTTCAT
GCTTCTTATTACTTCCAAGCAAATTGCTGCATTTTAGTTTTTGACATTACAAGAAAAATC
ACCTATTTAAATCTTAAAAAGTGGTACACTGAAATGAGAGAACACTGTCCAGACATCCCT
TGTATATTAATAGCCAATAAGATTGATGCTGATCGTAATGTCACCAACAAGTAGTTTAAG
TTTGCAACCCAACATAACTTACCCTTCTATTTCGTTTCTGCTGCTGATGGAACAAACGTA
GTTAAAATCTTCTAAGAAGCCCTTAGATTAGCTTTAGATAATAAGATCAATCCTCCCAAT
AAAGATGATAAATTTTTCGAGGATCTTATAAATGATAAAGACTTGTTCGATGACTTAGAT
GATTGA


>TTHERM_01085550(protein)
MHFKLKEKIKKKLKIQKIKKPIKKLLTYLFILKMDNKSKKQVKEYDAKEFSPCDMKVILL
GDSAVGKSKLVERFLLDDYEERNMSTYALTMYRHVANLDGKQYKIDIWDTAGQEQFQTLH
ASYYFQANCCILVFDITRKITYLNLKKWYTEMREHCPDIPCILIANKIDADRNVTNKQFK
FATQHNLPFYFVSAADGTNVVKIFQEALRLALDNKINPPNKDDKFFEDLINDKDLFDDLD
D


>TTHERM_01085550(gene)
ATGCATTTCAAGTTAAAAGAAAAAATTAAAAAAAAATTAAAAATATAAAAAATTAAAAAG
CCAATTAAAAAGCTACTTACTTACTTATTTATTTTGAAAATGGATAATAAATCAAAAAAA
CAAGTCAAAGAATATGACGCTAAGGAATTTTCTCCTTGCGATATGAAAGTCATTTTACTA
GGTGACTCAGCAGTTGGAAAATCCAAGTAACTAGCCTTTTAAATTGATATTTTTTACTTA
AGAGTCTAAATTTAGATTCAATTTATTTAATACTAATTGCTTTTAACATCAACAATTATT
TTATAAAATAGGCTTGTCGAAAGATTCTTGCTTGATGATTAGTAATTGATTTTTTTAAAT
AAACCATCTTGCATTTTACTTATTGTTAAAGCTTCTAAAATCTATTTTTTTAACTATTAG
CGAAGAGAGAAATATGTCAACTTACGCATTAACCATGTATCGTCATGTAGCTAATCTTGA
TGGAAAGCAATATAAGATAGGTAAATTGCATTAAAAATACATTAGAATTTTCTTTGTTTT
TTATCATTTTTAGATTGTGTAATACTTTTTTAACTTTTACTTGTTTTAAACAGATATTTG
GGACACTGCAGGCTAAGAATAATTCCAAACTCTTCATGCTTCTTATTACTTCCAAGCAAA
TTGCTGCATTTTAGTTTTTGACATTACAAGAAAAATCACCTATTTAAATCTTAAAAAGTG
GTACACTGAAATGAGAGAACACTGTCCAGACATCCCTTGTATATTAATAGCCAATAAGAT
TGATGGTATTTAATTATTAGTTTTCATATTAATTTAAGCTAACCAAAATAGATTTAAATA
ACCAATTTAATAAATAAATATAGCTGATCGTAATGTCACCAACAAGTAGTTTAAGTTTGC
AACCCAACATAACTTACCCTTCTATTTCGTTTCTGCTGCTGATGGAACAAACGTAGTTAA
AATCTTCTAAGAAGCCCTTAGATTAGCTTTAGATAATAAGATCAATCCTCCCAATAAAGA
TGATAAATTTTTCGAGGATCTTATAAATGATGTAAAGATTCAAATAGAATTAAATAAATT
TAATTTTAATTTATTTTACTTCGATAAAATTAGAAAGACTTGTTCGATGACTTAGATGAT
TGA