Identifiers and Description

Gene Model Identifier

TTHERM_00575490

Standard Name

RABX29 (Rab-like)

Aliases

PreTt28939 | 77.m00151 | 3812.m02634

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00575490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04017.15.001636743996964e-56hypothetical protein (217 aa)
OxytrichaContig17842.0.g1100.00000000002000577768187062Ras family
SGDYFL038C0.0000000020002373268528243YPT1 Rab family GTPase, involv
ed in the ER-to-Golgi step of
the secretory pathway; complex
formation with the Rab escort
protein Mrs6p is required for
prenylation of Ypt1p by prote
in geranylgeranyltransferase t
ype II (Bet2p-Bet4p)
DictyBaseDDB_G02692380.00000008001913847069386rab11A on chromosome: 1 positi
on 4269122 to 4270264
WormBaseWBGene000042660.00000019998969434520019locus:rab-1 status:Confirmed
UniProt:Q9UAQ6 protein_id
:CCD67094.1
Stentor CoeruleusSteCoe_49910.000045399929762484854

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575490(coding)
ATGAACTTTAATCTTTGTGCAGCATTTAAAAAGTGCTCTGAACCTTCTAATAAAAGGAGA
ATGTAAAAAAAGACTTTTGATGCTACTGCTATGATGATTGGGGAATCCAAAGTTGGCAAA
AGCTCTATCCTAGATGCTATCAATAATTAAAATTTTAATCCAAGCTATAGAAGAAGTCAA
AATTACGATTACTAAAACTTCAAGTTGGATGACGAAGGTACTAAGACAGTATATAATTTC
AAGGTTTGGGAGGTTAATTGTGTCTTCCATCTGATCAACTTAAAATCAGCTAAAATCTTA
TTTTATGTTTTTGCTTTCGATGACTTAGAGAGCTTCAACTCAATTTGCAAGTATAGATAA
ATGCAAACATTTTCTAGTCCTCTTGAGCAAACATTTATATAGAAACCGATTGAATTTATG
GTTGGGAACAAATCAGACATATAAGATAAAGCCGTAGATTCAAAAGTAGCCTAGGAATAC
TCATTGAAACATGATATGATATACATAGAAACATCATGTTTAAATATGGAGAGCATCAAA
AACTTAATAGGCGAAACGATTTAAAACTTAAATAATATGACATAAATCTAGCATAGCAGC
AACTCTTAAAACAAAACAAAGATTACAAGTAAATTATAACAAGACTGA


>TTHERM_00575490(protein)
MNFNLCAAFKKCSEPSNKRRMQKKTFDATAMMIGESKVGKSSILDAINNQNFNPSYRRSQ
NYDYQNFKLDDEGTKTVYNFKVWEVNCVFHLINLKSAKILFYVFAFDDLESFNSICKYRQ
MQTFSSPLEQTFIQKPIEFMVGNKSDIQDKAVDSKVAQEYSLKHDMIYIETSCLNMESIK
NLIGETIQNLNNMTQIQHSSNSQNKTKITSKLQQD


>TTHERM_00575490(gene)
ATGAACTTTAATCTTTGTGCAGCATTTAAAAAGTGCTCTGAACCTTCTAATAAAAGGAGA
ATGTAAAAAAAGACTTTTGATGCTACTGCTATGATGATTGGGGAATCCAAAGTTGGCAAA
AGCTCTATCCTAGATGCTATCAATAATTAAAATTTTAATCCAAGCTATAGAAGAAGTCAA
AATTACGATTACTAAAACTTCAAGTTGGATGACGAAGGTACTAAGACAGTATATAATTTC
AAGGTTTGGGAGGTTAATTGTGTCTTCCATCTGATCAACTTAAAATCAGCTAAAATCTTA
TTTTATGTTTTTGCTTTCGATGACTTAGAGAGCTTCAACTCAATTTGCAAGTATAGATAA
ATGCAAACATTTTCTAGTCCTCTTGAGCAAACATTTATATAGAAACCGATTGAATTTATG
GTTGGGAACAAATCAGACATATAAGATAAAGCCGTAGATTCAAAAGTAGCCTAGGAATAC
TCATTGAAACATGATATGATATACATAGAAACATCATGTTTAAATATGGAGAGCATCAAA
AACTTAATAGGCGAAACGATTTAAAACTTAAATAATATGACATAAATCTAGCATAGCAGC
AACTCTTAAAACAAAACAAAGATTACAAGTAAATTATAACAAGACTGA