Identifiers and Description

Gene Model Identifier

TTHERM_00780800

Standard Name

RABX27 (TTHERM_00780800)

Aliases

PreTt01292 | 130.m00102 | 3738.m00038

Description

RABX27 cyclic nucleotide-binding domain protein; Ras family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF07813 ) LTXXQ motif
  • ( PF08477 ) Miro-like protein
  • ( TIGR00165 ) ribosomal protein S18
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR03156 ) GTP-binding protein HflX
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00780800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18677.19.997093137033517e-262hypothetical protein (1672 aa)
OxytrichaContig15198.0.0.g260.00000019998969434520019Cyclic nucleotide-binding doma
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780800(coding)
ATGAAAAAAACTTAAGAAAGATAGGAACTAAGTGAACTAGAAGTAAGAACAAATTAGTAG
ATAAAAGAATTGCACAAAAAAAAGCTGGACGATTTAGTCGAAAAAGAGTATAATTCTAAA
AAGACTACTTGTATTCTTCCATAGTTGGAAAGATAAAATATTGTTAAAAATGAATCAGAT
GTGCTGTATGCAGTTTCAGAAATAAAGCAATTTCCCATCATTTAAGATTATTAAATGAAG
GACATTGAGTGCAATAAGTTTTGTTATCATTTCATTGAGTAGATGTAATATACAGTTGTT
TAGTTGGGTGAATAGATACTATATAATTATTTAACAGAAGATATTATTTGTTTCTTGCTT
AAAGGAAAAGTATCAATTTACTAAGAAAAGACCACTTCTCAAATTGAGGAGGACCTTATA
GAATATTTTAAAGTTCACTACCACTAAATAAGTTTACAAATCAAAGAAAATAATCTTTAA
ACGAAACTAAGAGAATTTATGAAAGACTTATCTTCCTCAGCAAATAAAAAAATATAATAA
ACTTCAAATTAAATTAGTAAAGGAAGTAGTAAAGAAATACAACAAGATGATCAAATTAAA
CATTATTTTGATAAAGAAGAGTTAAGAATACTATAATCAATAGTTAGAGAACTTATTATT
AAAGGAATATTTTAACTTATTGACTAATAAGCTTAGAGTTAAATGGATTTGCATGAATAA
TAATAAATATTATTGCTATGGTACTAACCTAGAACAGATTATTATTTTAATGAGTGGGGA
ATTCCTAAATATTTTGAAGTGCAATCATTTTATTCAGGAGATCATTTCTCAAGTTAGAGA
TTCTTTTAGGAAAAAGAAAAGTAAGTCTATTTGATGGTAGCAGCTGATGATTTGCATATG
ATTACAATGAAAAGATCTTCATATGAATCTATATCAAACTACTAACCAGATTCACAAAAA
GAAAAACTCAAGTTTATTGGGGATAAATTTAAAGATATATCTAAGAATACAGTACTAAAA
TTTATTTATCACTTCAAAAAAAAAGAATTTAAAAGAAAGGAACACTTATGGAGAGAAAAT
GAAAAAGTTGAAGGGATTTATTTTATTTAAAGCGGTGAAGTAGAATATTTAAAATCTTAT
AAAACAAAATCAAGTTTAATAAAGAAATAAGACAATTTAAATCAACAAGAAATGGAGCTG
ATAGTTAAGAATGACTAAAAGGTCTAATTATTACAAGTTTGCACATTTCATCAAGGAGAT
TTTATTGGAGAAGAGGATTTATTTGAATCTATAAGGTCTTATTCAGCTGTGGCTAAAAGT
GAAATAGTGATTATTTAGTATTTATCTTTAGATGATTTAGGAATTATAAAAAATTTTATT
TCAGAAATATATTCTTAATTGACAAGCAGGATAGATTCAAAAAAACGAAATCTTGATTAA
AAATTAAATATTGCTATTTAAAATAATAATTAAAAAGGAGATCAAAAATCTATAATAGAA
ATACTCTCCAATTAAAAACATAGTAGATAATTGAAAAATTTAAATGAAAAGGATAAAAAA
AGAGAGATATAAAAGCTCATAGAAACCAAAGAGCAAACTAAATTTACAAACACTAATGAT
ATAAAATAAATAGATAAGCTAATTAGAAGTGAATTCGGCAAAAAGAGATATCTTCAAATG
ATCAAAGATAATCCTTAAATTGTTTTATCCAAATAACCCAGATATCAAATTTTGTCAATA
CAAAATTAATTAAATAATCTTAAATAAAATTAATAAAATATCGAAATAACCTTAAAAACT
GAGCCATAAAACCTTTAAAAGAGTTCTTTGTCTTAAATGCTAGATAGTTCTAAAAATATT
AAAACGGATACTATATTTAAGTCTTCTATTAGATGTAATAACTCTACATCAAAATTACAC
GATAAATAAAAATAAGAGTCTTCTATTAGCAATATAGCCTAAATAAATAATTCAACAGTA
TGTAATACTAAAAGAGATAGTGCTATTATTTGGAAAGGCATAGAAAAAAATTTATAAAGT
TAATCTAATCCTTATTTGAATAATGTACTTATCGATAATTAGAATTTAGATTATAGGGAT
AAGTTTAATTAATAAGCTAGGCCAATTAGTTCTTAAGTTTATTCAAATTTGAAAACAAAT
ACAAGAAACTAATTTATTAACACTCAGTTTATTAATAAAGTTGATGAAAAGTCGCCAATT
GTTATTAAATCATTGCAATTAAACGATTTTATAAACTTCGATAAACTAAGATTAAACCCT
AAATAGAGACCAAACAGTTCTTTAATAGCATCTAAAACGTCCCCAACATAACCTAACATT
TACCAAAAATAAACATTCATGCCTACAGAAGTTTCATATTAAAATAATACTTCTTTAGCT
TCTCCATCAAATCAACAAAGCTAAATAAATAATTTAATTTCATCAAAAAATAGCGTTTGT
TTTTCATAATTAAGGACAACACTAAATTTAAATTCACCCTTGATACAGTCAAATAGAAAA
TTTTTCTAATCAAATATATAAGATATCCAGAACAAAACAAGTTTATCGTATTAATAAAAG
TAAAACTTAACTTAAAATTAAAGCAGTCCTAAAGTAAGTAGTATAGAATAGTAAAAAATA
TTACCATTTAAAAGAATCCACTCAGCAACTGCTAGAAAAAAGTTAAAAAAAAATACAGTT
ATAAACCAAATAATAAATTAATATAAAAAAAGTAATGGTCTTATATTGGTTCCTAATGAT
TTGTTAATTTCTGAAAATAATAACACAAGCATTAAGTGA


>TTHERM_00780800(protein)
MKKTQERQELSELEVRTNQQIKELHKKKLDDLVEKEYNSKKTTCILPQLERQNIVKNESD
VLYAVSEIKQFPIIQDYQMKDIECNKFCYHFIEQMQYTVVQLGEQILYNYLTEDIICFLL
KGKVSIYQEKTTSQIEEDLIEYFKVHYHQISLQIKENNLQTKLREFMKDLSSSANKKIQQ
TSNQISKGSSKEIQQDDQIKHYFDKEELRILQSIVRELIIKGIFQLIDQQAQSQMDLHEQ
QQILLLWYQPRTDYYFNEWGIPKYFEVQSFYSGDHFSSQRFFQEKEKQVYLMVAADDLHM
ITMKRSSYESISNYQPDSQKEKLKFIGDKFKDISKNTVLKFIYHFKKKEFKRKEHLWREN
EKVEGIYFIQSGEVEYLKSYKTKSSLIKKQDNLNQQEMELIVKNDQKVQLLQVCTFHQGD
FIGEEDLFESIRSYSAVAKSEIVIIQYLSLDDLGIIKNFISEIYSQLTSRIDSKKRNLDQ
KLNIAIQNNNQKGDQKSIIEILSNQKHSRQLKNLNEKDKKREIQKLIETKEQTKFTNTND
IKQIDKLIRSEFGKKRYLQMIKDNPQIVLSKQPRYQILSIQNQLNNLKQNQQNIEITLKT
EPQNLQKSSLSQMLDSSKNIKTDTIFKSSIRCNNSTSKLHDKQKQESSISNIAQINNSTV
CNTKRDSAIIWKGIEKNLQSQSNPYLNNVLIDNQNLDYRDKFNQQARPISSQVYSNLKTN
TRNQFINTQFINKVDEKSPIVIKSLQLNDFINFDKLRLNPKQRPNSSLIASKTSPTQPNI
YQKQTFMPTEVSYQNNTSLASPSNQQSQINNLISSKNSVCFSQLRTTLNLNSPLIQSNRK
FFQSNIQDIQNKTSLSYQQKQNLTQNQSSPKVSSIEQQKILPFKRIHSATARKKLKKNTV
INQIINQYKKSNGLILVPNDLLISENNNTSIK


>TTHERM_00780800(gene)
ATGAAAAAAACTTAAGAAAGATAGGAACTAAGTGAACTAGAAGTAAGAACAAATTAGTAG
ATAAAAGAATTGCACAAAAAAAAGCTGGACGATTTAGTCGAAAAAGAGTATAATTCTAAA
AAGACTACTTGTATTCTTCCATAGTTGGAAGTATATATTTAATTTTATAAAAGTTTTACA
AAATTTGTATTTCATAAAATATAAGGGCTTACTTCTACTTTATCAGAGATAAAATATTGT
TAAAAATGAATCAGATGTGCTGTATGCAGTTTCAGAAATAAAGCAATTTCCCATCATTTA
AGATTATTAAATGAAGGACATTGAGTGCAATAAGTTTTGTTATCATTTCATTGAGTAGAT
GTAATATACAGTTGTTTAGTTGGGTGAATAGATACTATATAATTGTAATATATAAATTTT
AAAAATGCTTATTTAGAAATAAATATTTTTCCTTACTTTCCAATTTTAATGTTATATAGA
TTTAACAGAAGATATTATTTGTTTCTTGCTTAAAGGAAAAGTATCAATTTACTAAGAAAA
GACCACTTCTCAAATTGAGGAGGACCTTATAGAATATTTTAAAGTTCACTACCACTAAAT
AAGTTTACAAATCAAAGAAAATAATCTTTAAACGAAACTAAGAGAATTTATGAAAGACTT
ATCTTCCTCAGCAAATAAAAAAATATAATAAACTTCAAATTAAATTAGTAAAGGAAGTAG
TAAAGAAATACAACAAGATGATCAAATTAAACAGTAAATAACTTAACAAAATAATAGCTA
AATAGCAAATACAAACATAAAATAAAGAAGGTAAAGTGATACATTTAAAAATTAGAAATA
GTTCTTACAAAAAGTAGTGAATGAACAATAATCAAACAATATATTTTATAGTTATTTTGA
TAAAGAAGAGTTAAGAATACTATAATCAATAGTTAGAGAACTTATTATTAAAGGAATATT
TTAACTTATTGACTAATAAGCTTAGAGTTAAATGGATTTGCATGAATAATAATAAATATT
ATTGCTATGGTACTAACCTAGAACAGATTATTATTTTAATGAGTGGGGAATTCCTAAATA
TTTTGAAGTGCAATCATTTTATTCAGGTTTAGATAATTTATTAAAATTATTAAATTTTTA
CAAAAATATTTTATATTAAAGGAGATCATTTCTCAAGTTAGAGATTCTTTTAGGAAAAAG
AAAAGTAAGTCTATTTGATGGTAGCAGCTGATGATTTGCATATGATTACAATGAAAAGAT
CTTCATATGAATCTATATCAAACTACTAACCAGATTCACAAAAAGAAAAACTCAAGTTTA
TTGGGGATAAATTTAAAGATATATCTAAGAATACAGTACTAAAATTTATTTATCACTTCA
AAAAAAAAGAATTTAAAAGAAAGGAACACTTATGGAGAGAAAATGAAAAAGTTGAAGGGA
TTTATTTTATTTAAAGCGGTGAAGTAGAATATTTAAAATCTTATAAAACAAAATCAAGTT
TAATAAAGAAATAAGACAATTTAAATCAACAAGAAATGGAGCTGATAGTTAAGAATGACT
AAAAGGTCTAATTATTACAAGTAAATTATTATATTTAATTAAAATATCTTATATTTTATG
ATAACCAATCACTTAGGTTTGCACATTTCATCAAGGAGATTTTATTGGAGAAGAGGATTT
ATTTGAATCTATAAGGTCTTATTCAGCTGTGGCTAAAAGTGAAATAGTGATTATTTAGTA
TTTATCTTTAGATGATTTAGGAATTATAAAAAATTTTATTTCAGAAATATATTCTTAATT
GACAAGCAGGATAGATTCAAAAAAACGAAATCTTGATTAAAAATTAAATATTGCTATTTA
AAATAATAATTAAAAAGGAGATCAAAAATCTATAATAGAAATACTCTCCAATTAAAAACA
TAGTAGATAATTGAAAAATTTAAATGAAAAGGATAAAAAAAGAGAGATATAAAAGCTCAT
AGAAACCAAAGAGCAAACTAAATTTACAAACACTAATGATATAAAATAAATAGATAAGCT
AATTAGAAGTGAATTCGGCAAAAAGAGATATCTTCAAATGATCAAAGATAATCCTTAAAT
TGTTTTATCCAGTAAATCATTTTCGTTTTTCAATGGTTATTACTTTAATTATATTTTTTC
TTCAATAATATTTAAAAATAGATTCAACATTAAATTCACTGGAGTCTGTAATGAGTTTCA
CTGATATTTAAAAAAAGTAAGAATAATCACCTTAAAAAGATGAGAGAAATAAATTAAGCA
TATAATAATCTAAATAAAATAAAAATATTTCTTAACAATAAAGTAGCTCTCAAAATTGTT
CTTTTCTTTTATTAAATGATGATCAATAAAAAAAAAGAATAGCAGCTAACAAGATTTGAA
AAATCAAATGAGAAAATCAATTAAAAATGTTATGAATCTCAATAAATTTTTATTTAAGTT
CAAAACAAAAAAAGATAGTTCAAAAAATAGTGAAGATGGTTCTAATATTCCATCTTACAA
TGATTTTTTTTCAAATGAGGTGGACACTATTTTAGATAGTTAAAAGCCTTGCAATTCAAA
TAATTCTTAGCCAAAGCTGACAAAAGTTCAAAGTTCTAATTCAAGTTATTAGTAACCCTT
AGCTTTGTAGCCTTAGATATCTTCATCAATCACAGGAAGCTCTAACCCTTAAAAAGACAA
ATAAAAGAAAATTACATATAAAGAGAGATAGTAAATTTAATAACAAAAACTAATGAAAGA
AATTAATTCACAATAATTTTAAAATTTAAAACATTTTCTTTCTAACAAGCAAATTGAGCA
TCTTGCTATCAAAAAACTAACATAAAAAGAAAATTATAAGGATAGAAATAAATTAACCAT
ATTCGAGTAACAGCAAGTAAAGAAAAGTTTATTAGAAAAACCTATAAGGCAAGGATAAAA
AAATGTATTGACAGATGAATAAAAGATGTAAATTAAAACAGCATTACAATCTCTACTGCT
AAACAATTCTTAAAAGTTAGAGAGTGATTTTATTTTCAAGGGAGTCTAAACTTAGTAGTC
AATCAAATAGCTTTAATTGAAGATGTATTAAAAGCTATAGTAAAAACCTGGAATGTAAAG
TTTATGCCTTTCCCCACATATTAAATCAAAAAGGAGTAGCCTAGCTAATTCGTTGGCTGT
ATCTCGCAAACAAAGCTAACAACTTGAAATTATAAATTAATTATAATTAAGTTAACCTAA
TTCACCTACTTCTTCTGATTCTTCTCCTAATATATTTAAATCAACTCATTTATTTTCTCA
GAATTCCAATTAAATGAAATCTACCCCTTAAAATTTTTCTCCCCTAAGTACCACTGATAG
ATTTTTTGAGTAAAGTTGTATAAAATAAATATGTAATGATCATGTTAATGATAGTGTGAT
AGAAGAAAGTAAATCTAATAGATAAAAAATTGGGTGTAATTCTTTAAGTGTTGATACAAG
TTATTCAATTTTGACTGAGTAATCTTATCAGTAAAATTAACTTGCAATTTGTGTACACCG
AAGAGTCTAATCTGGTAAAGCAAGAATTTAGTTAAATAAACCTTAATCTCCTATATTGTT
CTCTAGAAACCATAATCCTAAGTATTAATTTTCATCATCATTTTCTTCTTCTTCAAATAA
TCAAACTGCAAAGAAATATAAATAAAACGATATTTAAATAGAATAACCCAGATATCAAGT
AAATTTCCTTTTTCATATAAATTAAATTGATAACATTTTATTTATAAATTTTAGATTTTG
TCAATACAAAATTAATTAAATAATCTTAAATAAAATTAATAAAATATCGAAATAACCTTA
AAAACTGAGCCATAAAACCTTTAAAAGAGTTCTTTGTCTTAAATGCTAGATAGTTCTAAA
AATATTAAAACGGATACTATATTTAAGTCTTCTATTAGATGTAATAACTCTACATCAAAA
TTACACGATAAATAAAAATAAGAGTCTTCTATTAGCAATATAGCCTAAATAAATAATTCA
ACAGTATGTAATACTAAAAGAGATAGTGCTATTATTTGGAAAGGCATAGAAAAAAATTTA
TAAAGTTAATCTAATCCTTATTTGAATAATGTACTTATCGATAATTAGAATTTAGATTAT
AGGGATAAGTTTAATTAATAAGCTAGGCCAATTAGTTCTTAAGTTTATTCAAATTTGAAA
ACAAATACAAGAAACTAATTTATTAACACTCAGTTTATTAATAAAGTTGATGAAAAGTCG
CCAATTGTTATTAAATCATTGCAATTAAACGATTTTATAAACTTCGATAAACTAAGATTA
AACCCTAAATAGAGACCAAACAGTTCTTTAATAGCATCTAAAACGTCCCCAACATAACCT
AACATTTACCAAAAATAAACATTCATGCCTACAGAAGTTTCATATTAAAATAATACTTCT
TTAGCTTCTCCATCAAATCAACAAAGCTAAATAAATAATTTAATTTCATCAAAAAATAGC
GTTTGTTTTTCATAATTAAGGACAACACTAAATTTAAATTCACCCTTGATACAGTCAAAT
AGAAAATTTTTCTAATCAAATATATAAGATATCCAGAACAAAACAAGTTTATCGTATTAA
TAAAAGTAAAACTTAACTTAAAATTAAAGCAGTCCTAAAGTAAGTAGTATAGAATAGTAA
AAAATATTACCATTTAAAAGAATCCACTCAGCAACTGCTAGAAAAAAGTTAAAAAAAAAT
ACAGTTATAAACCAAATAATAAATTAATATAAAAAAAGTAATGGTCTTATATTGGTTCCT
AATGATTTGTTAATTTCTGAAAATAATAACACAAGCATTAAGTGA