Identifiers and Description

Gene Model Identifier

TTHERM_00470810

Standard Name

RAB7 (RAB GTPase 7)

Aliases

56.m00199 | PreTt22495 | 3686.m00042

Description

Putative Rab GTPase; putative member of the evolutionarily conserved Rab ramily which functions in regulation of membrane trafficking

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02528 ) ethanolamine utilization protein, EutP
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14%

TetraMine Data

TTHERM_00470810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11358.15.001524836186341e-138Ras family protein (210 aa)
WormBaseWBGene000042714.9994004612166366e-86locus:rab-7 status:Confirmed
UniProt:Q23146 protein_id
:CAA91357.1
DictyBaseDDB_G02692364.001073573587828e-83rab7A on chromosome: 1 positio
n 2627248 to 2628493
OxytrichaContig15386.0.g211.0004671766404936e-76Ras family
SGDYML001W6.99980278126514e-75YPT7 Rab family GTPase; GTP-bi
nding protein of the rab famil
y; required for homotypic fusi
on event in vacuole inheritanc
e, for endosome-endosome fusio
n, similar to mammalian Rab7
Stentor CoeruleusSteCoe_331415.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11387043: Stenmark H and Olkkonen VM (2001) The Rab GTPase family. Genome Biol 2(5):REVIEWS3007
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00470810(protein)
MSTNKRKQLYKIIILGDSGVGKTSLMNQYVNQRFTQQYRATVGADFMAKEVTIDDRMVTL
QIWDTAGQERFQSLGGAFYRGADCCVLVYDITNKKTFENLESWKEEFKQQGCPKDPDTFP
FVVIGNKSDKASERKVETEFAQQWCKSNGDIKHFETSAKDDTNVNAAFMAIAKAASSQFQ
EDAIFFPPKPVVLQTDKAKKKEKKDDCPC


>TTHERM_00470810(coding)
ATGAGCACAAATAAAAGAAAGCAACTCTACAAGATTATCATCTTAGGTGATTCTGGTGTA
GGAAAGACTTCTCTTATGAACCAGTACGTCAACTAGCGTTTTACTCAACAATATAGAGCT
ACAGTTGGTGCTGATTTCATGGCTAAGGAAGTCACTATTGATGATCGTATGGTTACATTA
CAAATTTGGGATACCGCTGGTCAAGAACGTTTCTAATCCCTCGGTGGTGCTTTCTATAGA
GGTGCTGACTGCTGTGTTTTGGTCTATGATATTACAAATAAGAAGACCTTTGAAAACTTA
GAAAGTTGGAAAGAAGAATTTAAGCAACAAGGTTGCCCTAAAGATCCTGACACTTTCCCA
TTTGTTGTTATTGGAAATAAAAGCGATAAAGCATCAGAAAGAAAAGTTGAAACTGAGTTT
GCTCAATAATGGTGCAAATCTAATGGAGACATTAAGCACTTCGAAACATCTGCCAAGGAT
GATACTAATGTTAATGCTGCTTTTATGGCTATTGCTAAGGCTGCCTCCTCTTAATTCTAA
GAAGATGCCATCTTCTTCCCACCAAAGCCTGTTGTTTTGTAAACTGATAAGGCCAAAAAG
AAAGAAAAAAAGGATGACTGCCCTTGTTGA


>TTHERM_00470810(gene)
ATGAGCACAAATAAAAGAAAGCAACTCTACAAGATTATCATCTTAGGTGATTCTGGGTAA
ATGATCCATACTAATTCTTAATTGCAGCGATTGACATTTTTAATTATATTTCAGGATTAT
GTGCTATTTTATCAGCATAATAAGCTTGAAAATTGTGATTGTGCAGAAATTCATCTATTA
ATTTTTTTAACCCATTTTTATTAAAATAAATAGTGTAGGAAAGACTTCTCTTATGAACCA
GTAAAATGTTTTTACAGTTATTAGCATTAAAATAAATAGTTGGGCTGTTAAATAGTCTAA
AGATCAGAATAGCAGAAATTTATTTTTTTTTTTGTTTTATTACAGGTACGTCAACTAGCG
TTTTACTCAACAATATAGAGCTACAGTTGGTGCTGATTTCATGGCTAAGGAAGTCACTAT
TGATGATCGTATGGTTACATTACAAGTAATTAATATAACAAATTTTCAGTTATTTATTAA
GTTCTAGTCCAAGAATTATTTTGCCCATATGATAGAATTGTTATTTTATCTATAAAGCAG
CATTCATTTTTGCAGCAAATCTTAAATATAACTACATCATTGTTATTGATTAGTCATTAA
TAAAATTTTTAATTTTTGATAAAAATAAATATTCGTTTATAATTATTAGATTTGGGATAC
CGCTGGTCAAGAACGTTTCTAATCCCTCGGTGGTGCTTTCTATAGAGGTGCTGACTGCTG
TGTTTTGGTCTATGATATTACAAATAAGAAGGTAATTAAATAAATATTTTATGCATAAAA
TAAAGTTAGCAGAATTATAATTTGTTATCTGAAGATCTTACTTGAAGATAAATATTTACA
AATTAGCACAAGTTTTCAAATATTTTTAAATCAACATTTTTTTTATAAAAATTATTTAGA
CCTTTGAAAACTTAGAAAGTTGGAAAGAAGAATTTAAGCAACAAGGTTGCCCTAAAGATC
CTGACACTTTCCCATTTGTTGTTATTGGAAATAAAAGCGATAAAGCATCAGAAAGAAAAG
TTGAAACTGAGTTTGCTCAATAATGGTGCAAATCTAATGGAGACATTAAGCACTTCGAAA
CATCTGCCAAGGATGATACTAATGTTAATGCTGCTTTTATGGCTATTGCTAAGGCTGCCT
CCTCTTAATTCTAAGAAGATGCCATGTAATTTTACTAGAATTTAATTATTTTAGCTTGTT
CAATAGTAATGAGAAAATCAATATAAATTCACTCAATAAGTTTACATTAAATGGAGTTCA
TAATATGAAATATATAAATAAATGAATAAATGAGTATTGATTTCATCATCTAAAAAACGA
AATTTATACACAATTAAAAACAATAAATTAATACCCTATGAATAAAATATTTAACTTTAA
TCTTTAATTATTAAAAGCTTCTTCCCACCAAAGCCTGTTGTTTTGTAAACTGATAAGGCC
AAAAAGAAAGAAAAAAAGGATGACTGCCCTTGTTGA