Identifiers and Description

Gene Model Identifier

TTHERM_00079900

Standard Name

RAB6C

Aliases

PreTt10235 | 5.m00586 | 3828.m01498

Description

Rab VI family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.9%

TetraMine Data

TTHERM_00079900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06960.12.999370583638828e-134Ras family protein (227 aa)
DictyBaseDDB_G02680681.000296925633081e-74rab6 on chromosome: 1 position
1398472 to 1399280
WormBaseWBGene000042695.99869294248238e-71locus:rab-6.1 Ras-related pr
otein Rab-6.1 status:Confirm
ed UniProt:P34213 protein_
id:CAA77590.1
OxytrichaContig5831.0.g65.997672135862771e-69Ras family
SGDYLR262C3.0000115468388957e-66YPT6 Rab family GTPase, Ras-li
ke GTP binding protein involve
d in the secretory pathway, re
quired for fusion of endosome-
derived vesicles with the late
Golgi, maturation of the vacu
olar carboxypeptidase Y; has s
imilarity to the human GTPase,
Rab6
Stentor CoeruleusSteCoe_61771.0806392777072785e-30

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00079900(coding)
ATGCAAAACACTACTACAGGACCTGTCGTTAAATTTAAAATAGTTTTTCTTGGTGACTAA
TCAGTAGGAAAAACCTCTATCATCAATCGTTTTATTTACGATAACTTCACTGGAAGTGAA
TAACCTACTGTTGGTATCGATTTCATTTGCAAAACCCTATAAATGGATAATAAAACTTTG
AGACTTCAACTTTGGGATACTGCTGGTTAAGAACGTTTCAAGAGTTTAATTCCCAGTTAT
ATTAGAGATTCAAATGCAGCTATCATTGTTTACGATATCACTAATCAAAATTCCTTTAGC
AATGTCACTAAATGGGTAGAAGAGGTTAAAGAAGAAAGAGGAAACAACGCTTTTATTTTT
ATTTTAGGAAACAAATCTGATTTAGAAGATAGAAAGGTGTCTCTTGAAGAAGGATAGGCT
AAAGCAAAGTAATTTGGTCTTAACTTCTGTGAAGTCTCTGCAAAAACAGGATAAAATATT
AGCAGCTTTTTTAAGAATTTATCTATGACACTCAGTGGAGGAAACTCTAACGAAACCCCT
AATTAGTAGCTATAGACAGATAATAAGTCAGGACAACCATAATAGCCAAGTAATAATAAC
GATAATGCAAATAAAGGCCAAAAATTATAGAATCCTTCAAAAACTGATGATAAGGATAAA
AAGAAAAAAGGAGGATGTTGTTGA


>TTHERM_00079900(protein)
MQNTTTGPVVKFKIVFLGDQSVGKTSIINRFIYDNFTGSEQPTVGIDFICKTLQMDNKTL
RLQLWDTAGQERFKSLIPSYIRDSNAAIIVYDITNQNSFSNVTKWVEEVKEERGNNAFIF
ILGNKSDLEDRKVSLEEGQAKAKQFGLNFCEVSAKTGQNISSFFKNLSMTLSGGNSNETP
NQQLQTDNKSGQPQQPSNNNDNANKGQKLQNPSKTDDKDKKKKGGCC


>TTHERM_00079900(gene)
ATGCAAAACACTACTACAGGACCTGTCGTTAAATTTAAAATAGTTTTTCTTGGTGACTAA
TCAGTAGGAAAAACCTCTATCATCAATCGTTTTATTTACGATAACTTCACTGGAAGTGAA
TAAGTATAGCATTTTTAAGATAGTTAATTTTAAAAACTTATAATTGTAGTTAATTCTAAA
ATGCCTGTCAAATAATGCATTATGCATATCAAATTTATAATAAAAATACTTATTTAAATA
TTCAATATATTCAATTTTATTTTTTAATTATGTTAGCCTACTGTTGGTATCGATTTCATT
TGCAAAACCCTATAAATGGATAATAAAACTTTGAGACTTCAACTTTGGGATACTGCTGGT
TAAGAACGTTTCAAGAGTTTAATTCCCAGTTATATTAGAGATTCAAATGCAGCTATCATT
GTTTACGATATCACTAGTATATTCTATATTTTAAATATATTTCTAAGCAAAAAATAGTTT
TATGTTTCTTTTTTTGCTTCTAACGATTAATTATTATTTTGTATTACAAAGATCAAAATT
CCTTTAGCAATGTCACTAAATGGGTAGAAGAGGTTAAAGAAGAAAGAGGAAACAACGCTT
TTATTTTTATTTTAGGAAACAAATCTGATTTAGAAGATAGGTAAAAATTTAAATTTTCTC
AGCTATTAAAATTTGTTTATATATTGTGAACATAATAATAAAGAAAATTAAATTTTTTGT
TTTATTAATTAATCATACAGAAAGGTGTCTCTTGAAGAAGGATAGGCTAAAGCAAAGTAA
TTTGGTCTTAACTTCTGTGAAGTCTCTGCAAAAACAGGATAAAATATTAGCAGCTTTTTT
AAGAATTTATCTATGACACTCAGTGGAGGAAACTCTAACGAAACCCCTAATTAGTAGCTA
TAGACAGATAATAAGTCAGGACAACCATAATAGCCAAGTAATAATAACGATAATGCAAAT
AAAGGCCAAAAATTATAGAATCCTTCAAAAACTGATGATAAGGATAAAAAGAAAAAAGGA
GGATGTTGTTGA