Identifiers and Description

Gene Model Identifier

TTHERM_00467760

Standard Name

RAB6A

Aliases

PreTt18678 | 55.m00233 | 3710.m00082

Description

Rab VI family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00467760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15717.12.000893364583308e-148Ras family protein (229 aa)
DictyBaseDDB_G02680685.9988196117913e-83rab6 on chromosome: 1 position
1398472 to 1399280
WormBaseWBGene000042703.0005855096961235e-80locus:rab-6.2 Ras-related pr
otein Rab-6.2 status:Confirm
ed UniProt:Q22782 protein_
id:CCD74453.1
OxytrichaContig5831.0.g69.99711830094262e-74Ras family
SGDYLR262C9.004385969422137e-73YPT6 Rab family GTPase, Ras-li
ke GTP binding protein involve
d in the secretory pathway, re
quired for fusion of endosome-
derived vesicles with the late
Golgi, maturation of the vacu
olar carboxypeptidase Y; has s
imilarity to the human GTPase,
Rab6
Stentor CoeruleusSteCoe_61771.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00467760(coding)
ATGAACTCAGAAACAAAAGGATCAATAGCTACTCCCTTGTCAAAATATAAATTAGTATTT
TTAGGAGATTAGGGTGTAGGAAAGACATCAATTATTAACAGATTTATGTTTGACACATTT
GATGGAAAAGATCACCCTACAGTTGGTATTGATTTTATCTCCAAGACCCTCTATTATGAA
GATAGAACTATAAGATTACAACTATGGGATACAGCTGGATAAGAAAGATTTAGAAGTTTA
ATTCCTTCATATATTAGAGATAGCGCTGTTGCAGTTGTCTGTTACGATATTACAAACAAA
GTTTCATTCGATAATGTTGCCAAATGGATAGAAGATGTTAGGGCAGAAAGAGGACACGAT
GTCATTATTTGCTTAGTTGGTAGTAAAAATGATTTAGTTGACAAAAGGGTAGTATAAACA
ACAGATGGTTAAGTTAAAGCAAAAGAATTAGATGTCAAATTTTTTGAAGTTAGTGCTCTC
ACTGGTTAAAATGTATAATAACTATTTAGATCTATTGCTAATATGCTTCCAGGAGCAGAA
GTTAGCTAGCTTGCTCAGCTTTAAGGAGGAATGAACAAAAACGTAAATAATAACTAAGAA
GAAACAAAATAAAATTTTCAACTGGACTAAAACCAAACAGAAGAGCAAAATAAAGAAAAA
AAAGAAAAAAAATAAGGCGGCTGCTGTTGA


>TTHERM_00467760(protein)
MNSETKGSIATPLSKYKLVFLGDQGVGKTSIINRFMFDTFDGKDHPTVGIDFISKTLYYE
DRTIRLQLWDTAGQERFRSLIPSYIRDSAVAVVCYDITNKVSFDNVAKWIEDVRAERGHD
VIICLVGSKNDLVDKRVVQTTDGQVKAKELDVKFFEVSALTGQNVQQLFRSIANMLPGAE
VSQLAQLQGGMNKNVNNNQEETKQNFQLDQNQTEEQNKEKKEKKQGGCC


>TTHERM_00467760(gene)
ATGAACTCAGAAACAAAAGGATCAATAGCTACTCCCTTGTCAAAATATAAATTAGTATTT
TTAGGAGATTAGGGTGTAGGAAAGACATCAATTATTAACAGATTTATGTTTGACACATTT
GATGGAAAAGATCACGTAAATAATTCTTCTTCTTCTTTAAATGCTCTATAAAACCAATCC
ATAATTTGTAAATAAAAATGATCAACTGTTTTTAAAAATTTAAATAAAAACACAACTACA
TTAATGAAATATATTAAAGAGAATTAAGGAGAAATAGATTTAAAAATATAAATCATTAAA
TTATCTAAAAATAATTTGTTATTATATATTTGGGATTCGCTTAAATCTAGCTCATTTTAA
CTCCTTAATGAAATTATTTATTATAAATCATAAATATAAAAAAACAATCATCATATATAA
AGAATATTTAAATCTAAGAGTATATTTATTATAGCCACTTGAAACTTAGAATTATGGATT
AACTTTAAATAAAATTGAATATCTGAGTTAAATTAAAATAATTATTTTTAATATTAGCCT
ACAGTTGGTATTGATTTTATCTCCAAGACCCTCTATTATGAAGATAGAACTATAAGATTA
CAACTATGGGATACAGCTGGATAAGAAAGATTTAGAAGTTTAATTCCTTCATATATTAGA
GATAGCGCTGTTGCAGTTGTCTGTTACGATATTACAAGTAATTAGATAGCCTCATTCGAT
TTATATTAATATTTATTTTTCCTCCGACTAAAATAGACAAAGTTTCATTCGATAATGTTG
CCAAATGGATAGAAGATGTTAGGGCAGAAAGAGGACACGATGTCATTATTTGCTTAGTTG
GTAGTAAAAATGATTTAGTTGACAAAAGGTAAATATTATTAATTAAAAGTCATTCTTTAA
ACTCAATATGCTTTTTTGATTCAACTATTTAGGGTAGTATAAACAACAGATGGTTAAGTT
AAAGCAAAAGAATTAGATGTCAAATTTTTTGAAGTTAGTGCTCTCACTGGTTAAAATGTA
TAATAACTATTTAGATCTATTGCTAATATGCTTCCAGGAGCAGAAGTTAGCTAGCTTGCT
CAGCTTTAAGGAGGAATGAACAAAAACGTAAATAATAACTAAGGTATTTTATTTTAAAAG
AAAATTAACAAATAAATAAATAAACGAACAAAGTATATTTAAAAATATTAATTTTTATTT
TAATATCTAATAAACAGAAGAAACAAAATAAAATTTTCAACTGGACTAAAACCAAACAGA
AGAGCAAAATAAAGAAAAAAAAGAAAAAAAATAAGGCGGCTGCTGTTGA