Identifiers and Description

Gene Model Identifier

TTHERM_00637520

Standard Name

RAB68 (RAB)

Aliases

PreTt19755 | 91.m00170

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00637520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40856.12.000319284850678e-127Ras family protein (218 aa)
DictyBaseDDB_G02771014.000054831110256e-33rab11C on chromosome: 2 positi
on 7509311 to 7510238
SGDYER031C4.001033848388204e-30YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
OxytrichaContig9955.0.g638.00089003463867e-30Ras family
WormBaseWBGene000042742.000130478826482e-26locus:rab-11.1 status:Confir
med UniProt:O01803 protein
_id:CCD71701.1
Stentor CoeruleusSteCoe_347250.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00637520(coding)
ATGGCTGAAAGAAATAAATAAGAACCATTATAATTTAAAATATTTATTGTAGGTGATGCT
CAAGTTGGAAAGACTTATGTTGTAAATAAAATAATATAAAAATCTAGAAATTCTACTAAG
TATAAGCCTACTTATGGATTCAACTACCATATTTGGGAGCATGAGATCCATGAGAATAGA
CATGTAGTATTTTAACTTTGGGACACAGCTGGCTAAGAAAAATACAGAGGCATTACAAAA
GAGCACTACAAAAGTGGAGTTGGTGCTATAATAGTTTATGATATAACTAAAGAAGATTCA
TTTTGTAATGTAAAAAATTGGATAGAGGAGATTAAGAGCAATTGCATAGAGCAAGAAGAA
GAAGATCCATATATAATTGTAATTGGGAACAAAAAAGATCTAAAAAGTTAAAGAAAAGTT
GGGTATGAAGAGGCTTACTAAATTGTTAAGAAAGAAGATAAAGATATAGATATTTTTGAA
ATATCAACAGTTTCAGCAGATCCTGTTGATACTTCATATTTTGAAAAAGTAATCAACCAT
TTTTTTAAAAAAATATATGAAAGACTCAAAAAAAGAGGAATTCTATCTGATAATGATCCT
AATATTAGATTGGCTGATACACAAGTATAAACAAGTAAATCGTGTTGTTGTTGTTGA


>TTHERM_00637520(protein)
MAERNKQEPLQFKIFIVGDAQVGKTYVVNKIIQKSRNSTKYKPTYGFNYHIWEHEIHENR
HVVFQLWDTAGQEKYRGITKEHYKSGVGAIIVYDITKEDSFCNVKNWIEEIKSNCIEQEE
EDPYIIVIGNKKDLKSQRKVGYEEAYQIVKKEDKDIDIFEISTVSADPVDTSYFEKVINH
FFKKIYERLKKRGILSDNDPNIRLADTQVQTSKSCCCC


>TTHERM_00637520(gene)
ATTTTTTTTTGATTGAAATTAATTAAGTTATCTATCTTAATAACCTCTTAGCGTATCTAA
AAATAAGTTGAAACCAATGGCTGAAAGAAATAAATAAGAACCATTATAATTTAAAAGTAT
ATTACTAAGATAATTTCTATGATTAAAAATAAATTTGCTATAAATGTTTAGTATTTATTG
TAGGTGATGCTCAAGTTGGAAAGACTTATGTTGTAAATAAGTAAACATTTATTTATATTT
TGCTTTAAATTATGCCCACTCTTTTTAGAATAATATAAAAATCTAGAAATTCTACTAAGT
ATAAGCCTACTTATGGATTCAACTACCATATTTGGGAGCATGAGATCCATGAGAATAGAC
ATGTAGTATTTTAACTTTGGGACACAGCTGGCTAAGAAAAATACAGAGGCATTACAAAAG
AGTATTTATTTTGTTTTAAATAATTAATTAGTTAATGTGATAACCAATAATAGGCACTAC
AAAAGTGGAGTTGGTGCTATAATAGTTTATGATATAACTAAAGAAGATTCATTTTGTAAT
GTAAAAAATTGGATAGAGGAGATTAAGAGCAATTGCATAGAGCAAGAAGAAGAAGATCCA
TATATAATTGTAATTGGGAACAAAAAAGATCTAAAAAGTTAAAGAAAAGTTGGGTATGAA
GAGGCTTACTAAATTGTTAAGAAAGAAGATAAAGATATAGATATTTTTGAAATATCAACA
GTTTCAGCAGATCCTGTTGATACTTCATATTTTGAAAAAGTAATCAACCATTTTTTTAAA
AGTAAATTATTCCTTTTGTTAATTCTTCAACTTAGTTTTTCTTCAATGAATATCAGAAAT
ATATGAAAGACTCAAAAAAAGAGGAATTCTATCTGATAATGATCCTAATATTAGATTGGC
TGATACACAAGTATAAACAAGTAAATCGTGTTGTTGTTGTTGAAAAAGAAAATGTATAAA
AATAAATAAATAAATATTACCAGTAATATTAAACATAAAAATACTCAATTAAATTAGAGT
TTAATTTTAATAATGGCTTAATAGTTGGTTCTAAATTAAATCTAGTGCCCTATTTACTCA
TTTATTTAACATTTTATTATAAAAAAGTTTAAATTTTATTAATTTTTACTTATATTTACG
TATTGAAATTTTATAAAAAATACATATTTTAATTATGCAATACATGTTTGATAATTAAGG
GATTTAATTGTTTATTTGTTAAAATTCATTTCA