Identifiers and Description

Gene Model Identifier

TTHERM_00083670

Standard Name

RAB65 (RAB GTPase 65)

Aliases

PreTt16314 | 6.m00388 | 3836.m01984

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00083670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02392.19.996373193201036e-79Ras family protein (221 aa)
SGDYFL005W7.998505003885351e-50SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane
WormBaseWBGene000042739.999142814001536e-47locus:rab-10 status:Confirme
d UniProt:Q94148 protein_i
d:CCD70773.1
DictyBaseDDB_G02800439.999142814001536e-47rab8A on chromosome: 3 positio
n 3266503 to 3267523
OxytrichaContig11247.0.g573.998479955315009e-46Ras family
Stentor CoeruleusSteCoe_157785.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00083670(coding)
ATGAGTTAGAATAAGGATGATTAGCAAATTTATTTTAAAATATTAATGATAGGCAACTCA
GCAGTTGGAAATACATGTCTATTGGTGAGATATTGCAATAGTGAATTTCCAAATAGTAGC
ATAATCACATTGGGTATAGATTTAAAAATAAAAAAACTTGAAATTAATAAAAAAAAGCTT
AATTTGCATATTTTGGATACAGCTAGTTAGGATAAATTTAGAACCATTACTCCAAATTAT
TTCAAAGCAGCTCATGGTATTTTAGTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAG
AAAGTAGGAAGCTGGATTTAATGCATAAAAGAAAATTTCGATAATGCTAATATATCTATA
TTATTAGTTGGAAATAAATCTGATTCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAA
AAGCTTGCTGAGTAATATAATATTCCTTTTTAGGAAACTAGTGCTCTTAATAATATTAAT
GTGAGCGAATCTTTTTATTAACTTGCTAAAATGTGCTTAGATTAGTATGAGATAAAAAGT
TCTACTAGGTCTCCTTAATCTATTGTACCAAAGAAAAAATAAGAAAATGGAGAAACTAAA
AAAAATTGTTGTTGA


>TTHERM_00083670(protein)
MSQNKDDQQIYFKILMIGNSAVGNTCLLVRYCNSEFPNSSIITLGIDLKIKKLEINKKKL
NLHILDTASQDKFRTITPNYFKAAHGILVAYSVEDQESFEKVGSWIQCIKENFDNANISI
LLVGNKSDSKQRVVSLEQGEKLAEQYNIPFQETSALNNINVSESFYQLAKMCLDQYEIKS
STRSPQSIVPKKKQENGETKKNCC


>TTHERM_00083670(gene)
ATTAAAATTCAAAAAATAAATATACTTGAAAAGAAAGTAAAGTAAAAGGTTATTTGTGAA
AAATTGATTTATGAGTTAGAATAAGGATGATTAGCAAATTTATTTTAAAATATTAATGAT
AGGCAACTCAGCAGTTGGAAATACATGTCTATTGGTGAGATATTGCAATAGTGAATTTCC
AAATAGTAGCATAATCACATTGGGTATTGTATTTATTGATTATTTTAAAATTAAAAAAAT
AATGATCTAATTCAAAAAAATATAAACATGTAAAAGTAAATTTCTTTGTTAATAAAAAGG
TATAGATTTAAAAATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAATTTGCATATTTT
GGATACAGCTAGTTAGGATAAATTTAGAACCATTACTCCAAATTATTTCAAAGCAGCTCA
TGGTATTTTAGTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGAAGCTG
GATTTAATGCATAAAAGAAAATTTCGATAATGCTAATATATCTATATTATTAGTTGGAAA
TAAATCTGATTCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCTGAGTA
ATATAATATTCCTTTTTAGGAAACTAGTGCTCTTAATAATATTAATGTGAGCGAATCTTT
TTATTAACTTGCTAAAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTAGGTCTCC
TTAATCTATTGTACCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGTTGTTG
A