Identifiers and Description

Gene Model Identifier

TTHERM_00083660

Standard Name

RAB64

Aliases

PreTt16313 | 6.m00387 | 3836.m01983

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.1%

TetraMine Data

TTHERM_00083660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02392.15.000412888119721e-59Ras family protein (221 aa)
OxytrichaContig15751.0.0.g873.9990760533890984e-36Ras family
SGDYFL005W2.0006622580855403e-35SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane
DictyBaseDDB_G02837572.9990874792167046e-33rab1A on chromosome: 4 positio
n 1241175 to 1242406
WormBaseWBGene000042663.00033207980219e-32locus:rab-1 status:Confirmed
UniProt:Q9UAQ6 protein_id
:CCD67094.1
Stentor CoeruleusSteCoe_251602.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00083660(coding)
ATGAGAAAATATTCTAATTTCAAGATATGTGGTGCTGAATAAATTTTTATGATAAAAATA
CTTGAAAAAAAAGTAGAGTAAAAGGTTATTTGTGAAAAGTTTATTAATGAGTTTGAATAA
GGAACATTAGGAAATTTGTTTTAAGCTATTAATTATAGGCAACTAAGCAGTTGGAAAGAC
ATGTCTATTGCTGAGATATTGGAAAAGTAAATTTCCAAATAGTAACATAACCACATAGGG
TATTGTATAGATTATTATATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAAATTGTAT
ATTTGGGATACAGCTGGTTCGGAAAGATTTAGAACCATTACTTCAAATTATTTCAAAGCA
GCTCATGGTATTTTAGTAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGA
AGCTGGATTTAATGCATAAAAGAAAAATGCGATAATGCTAATATATCTATATTATTAGTT
GGAAATAAATCTGATTCAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCT
GAGTAATATAATATTCCTTTTTAGGAAACTAGTGCTCTTGATAATATTAATGTGAGCGAA
TCTTTTGATTAACTTGCTATAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTATT
TCTCCTTAGTCTAATATTCCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGT
TGTTGA


>TTHERM_00083660(protein)
MRKYSNFKICGAEQIFMIKILEKKVEQKVICEKFINEFEQGTLGNLFQAINYRQLSSWKD
MSIAEILEKQISKQQHNHIGYCIDYYIKKLEINKKKLKLYIWDTAGSERFRTITSNYFKA
AHGILVAYSVEDQESFEKVGSWIQCIKEKCDNANISILLVGNKSDSKQRVVSLEQGEKLA
EQYNIPFQETSALDNINVSESFDQLAIMCLDQYEIKSSTISPQSNIPKKKQENGETKKNC
C


>TTHERM_00083660(gene)
ATGAGAAAATATTCTAATTTCAAGATATGTGGTGCTGAATAAATTTTTATGGTATGATAC
TAACATGATATTCAATAATCAATTAACCTGTAAAGAAGTATTAAATTTTTATAAATTAAA
ACTCAAAAGATAAAAATACTTGAAAAAAAAGTAGAGTAAAAGGTTATTTGTGAAAAGTTT
ATTAATGAGTTTGAATAAGGAACATTAGGAAATTTGTTTTAAGCTATTAATTATAGGCAA
CTAAGCAGTTGGAAAGACATGTCTATTGCTGAGATATTGGAAAAGTAAATTTCCAAATAG
TAACATAACCACATAGGGTATTGTATTTATTGATTATTTTAAAATTAAAAAAATAATGAT
CTAATTGAAAAAAATATAAACATGTAAGTAAATTTTGTTAATAAAAAGGTATAGATTATT
ATATAAAAAAACTTGAAATTAATAAAAAAAAGCTTAAATTGTATATTTGGGATACAGCTG
GTTCGGAAAGATTTAGAACCATTACTTCAAATTATTTCAAAGCAGCTCATGGTATTTTAG
TAGCCTATTCAGTAGAAGACTAAGAATCGTTTGAGAAAGTAGGAAGCTGGATTTAATGCA
TAAAAGAAAAATGCGATAATGCTAATATATCTATATTATTAGTTGGAAATAAATCTGATT
CAAAACAAAGAGTAGTTTCATTAGAATAGGGTGAAAAGCTTGCTGAGTAATATAATATTC
CTTTTTAGGAAACTAGTGCTCTTGATAATATTAATGTGAGCGAATCTTTTGATTAACTTG
CTATAATGTGCTTAGATTAGTATGAGATAAAAAGTTCTACTATTTCTCCTTAGTCTAATA
TTCCAAAGAAAAAATAAGAAAATGGAGAAACTAAAAAAAATTGTTGTTGA