Identifiers and Description

Gene Model Identifier

TTHERM_00194460

Standard Name

RAB63

Aliases

PreTt06730 | 16.m00386

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • regulation of small GTPase mediated signal transduction (IEA) | GO:0051056

Domains

  • ( PF02145 ) Rap/ran-GAP
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF07540 ) Nucleolar complex-associated protein
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00194460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03716.19.997093137033517e-262hypothetical protein (1916 aa)
DictyBaseDDB_G02848257.998932288246191e-33DDB_G0284825 on chromosome: 4
position 2526025 to 2531286
WormBaseWBGene000187341.9999391735788327e-19status:Partially_confirmed U
niProt:H2L055 protein_id:CCD
71458.1
Stentor CoeruleusSteCoe_245890.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00194460(coding)
ATGAGCAATACAGATGATTAGGAGACTGCTATAATAAAGGCTTTTAATGCAAGCATAGAA
TTTATTTTAGATAAAGATAAAAAAACAAAGCATAGATTTTAGTAGTTAGTGGATGTTTAT
AAACAAATCAGGGATGAAGGAGAGCAATAAAATACTAGCAAGGATGAATAAGCAGATAGT
CAGAATTAGTAAAATCAACACTCAAGCAACCAGCCAGTTAATTAGTCATAGTTGAATTAG
TCAGCTAATAACTCATCAGGAGTGCTTAATATTAACGGAATATCTATGATGAAATTGCAG
CATAGAATAATAAAGAATATCAAACTCAATCATATATGGCACTAGTCCTTGAATCAAAAT
TACAGGGTCGTTTATGAACTGATTTAAGATCATCTTAATAAAATTAATCCAGGCTTTTTT
TAAAAGCTAATTAATCAGAATAATTAATGTAGAGATATCCTTTAAACATTAAAGTTACTA
TATTTTTTCTTTGACAGTTTAGAAAATGTAAATATTCAAGAATTATTGAAAGGAGTCTTT
CGCTTGCAAATCATTCAAACCATTTACTGCTGTCTCGATTATTAAAATAAAGAAGAAGCA
AGAATTTTAGGTTTTATTCTCCTTTTTAAGATTATTTCTAGCTATGATTTCAATCAGCTA
TTTAGGCTACAAGAACTATCCGTTCTTACGCTATTCAATTATATAATAGATTTTTAGTCA
TTTAGCAAACCATACTCTTAAAACTCTATTAAAGATGTCTGCGTTTTTAACAGTCCGAGC
AATGGAATGCCTGTTTGGACAAATTATATTAAAGATGTAAGCCACGAAAAATCAGAAAAG
CAATATCTAGATGAAATATGGAAATACATGCAATTGGATGTTAAAAATGTGAGAAAGTGG
TTGCTTATATTTTCTTAGACATGGTTTTAACTTTGTTTTGATAAAAGTTACCTTAAATGG
TCCGAAGAATATTTTAAGAGATAAGATACTGTTACCAAGCAATATTAAATGATCTATGGT
TTATCTACTGATTAAATTTTACTAGACTAAAATACTAAAATAAATTTAACATCAAGCTTT
CTTAAATAAATCAACTTTTTCTTTGTTATTCTTAGCACTAATAAGAAGGAAAAGTAAAAA
GAAAGAAGAAGCACAGCAGTTATTGCAGATTTAAGACACAAATTACTTAGTGAAAAAGAG
TATATGCACTATATAGATCTCCTACACAGCTATTTTGACAAAGAAGAATATTATAAAATA
GCAAATGATATAATAAGTACTTTTTCTGATCAAATGGCCAATTTTGGAGATCTTTTTCCT
GTTTATTATGAAAATGACAACATTGTCTTAATATCTTCTATTCTAATGAAAATCGAAGAG
AGTATAATACATGAGATGACTATCAGACAAAATCATTAGAAAAAGAAATAAAATTTTAAA
AAGGAAAATTATTAAGAATCCCATCTTTAAAGTCATACTAAGATTACTCCAAAAAGAGCA
GAAATTTACATAAACTGTTTATAAAAGTTAAATCATGATCAAATACGCTCTACTCCTTAC
TTCAAAACATTCTGCACAAAAGTTATTAAAATAGGAGAGGACTTATTAAATGAATGGATG
TAAAATAAAGACTAGGACTAAGAATAAAACTCTAAAGTGCTGATTGACTTGTTTTTCCTC
TTGATGAGTTATTAGGAAAGAATCTTTTTAGCATAGCTTGAAAAATCATTCAGAAAAGAA
GATTCTCATAAGCTGTTGGAAGAGAATAAGCTAAACAGCGAAGATATCATTCTCTTGAGA
GAGAAAATGCATCAAATGTCAATTGAATTATTAAACAGATACAACGTTTTAAAAAATTTA
AGTGACTATGTTAAAAATATTGCTTTTAAATTTATTGATACACTCTATTCTTAAGAGAAT
TTAGATATATTTTAAGGAGAAGTTGTTTATTTAGGAAATGTTTTGAAAAAGGAAAATTAG
CCATATTAGTTAGAAAATACTTTACAAATGATTTTAGATGTAATTAAAATAAGGCAAAAA
CTTTAGAAAGAGTAAAGATAAAGTGAAAGTGTCAACAATTAAATAAATTTACATACAATG
GTTGTGAAGGAGAGAAATTTATCTTAATCTCAAAAAAGTTCTGCTTCAATAGAATCAGAA
AATAATTCTAATCCTCTATAAAAAATTAATTATTCAAATATAGAGCCTCAATACAAAGAA
AAGCAAGATTAAAAAATACTGTAAGGAGTTTTAAAAAATTATCTAAACATGGGAAAATTA
CTTAATATGGAAGATGTTATTCTACTTGATGAGTATATAGGTAATTACAGTGAGACAAAT
ACAGAAAATAAACAGGAAGGCACAAATCCTAGGAATAATAACCAATAAAACTTGTCCTTT
AATAGGAAACGAGATAATTCAAATTAACAAAACCTTCCAAAATCGGATTTTTCAGAGGTT
GAACAAAGCGAATAAAATTCTAACAGCAGCTTCGTATTTGTGAATGCAAGCAATGAAAAC
AGTGAAACTTTATTTGCCTAAAAAAAGAATATTTAATTTAGTGAATAAATCAATAATGTT
TTGTAGTAAGAAGGAAATAACTCTGATAGTAATGAAGGGAGCGATTTTTTTCGCTTAGGC
AGCTAATTCTTGACAAAATAAGAAATTGATAGAAATATATCAAGGTTCATTCATTCAAAA
AAAAGTGAAGCAGAGGAATCTAACGATATATTGGAGGGTGCTTTAAGCTGTTCGAAAGAA
GAGTCACTAAATTCTTCTCCAAAGAAAAACAAATCATAGAATTCAAAAGAAAAAGGATAA
ACTTCTAAAATAAATGATTTGAAAAATCGAAGATCATCTTTGTATTTAAAAGATGAATAA
CAAAATAAATTAGAGTATCTTGTTATTTAATTCAATAATTTGATGTATAAAATAGATATA
ATTTGTAATAACTCAAATTTCGTAGATTTATAAAATCAGAACTTATCATGTAAATATACT
CAGTAAATAATCTATTGCTTCTTGACTCCTCACTAGAGCTAAAAGCATTCTAATTTCTTA
AATACTAGTTAAAGTCAAGCTTCTAGTTCTTTTAATATCTAAAATAAATAAAAACAATCA
TAAATAATAAGATATCCTCCATCAATAAATACTTTATTTTTTATATTTTACAGTTATTTA
AATATACAAAGTAAGTTAGAAACTTATTAGATCTTGTAAGATTTAGGTAACAAGCAATCA
AAAATATAAAAATTTGCTACAATCACAAATACAGCTTTTATTATGAAATCCTTTTTTCAA
ATATACAACAAAGCTCATTCTTAACAAAACGAAACCTTAGGAGAGATAGTTAATCAATGG
GAATAACTCTTTAATTATTGTCTTAACGAAGACACAGATCCAATCTTTAGCGTGGCAGCA
ATTGTAGTGAATAAAGATATTTTTTCAACTTATCCTGAATTAATGAAACATCACAGCTTG
ATTCATAAATTTTTAGAGAAATCAAAGTAAATTTTAGGATATTTGATAGACCCTGTTTCA
GCACCTGAAGATTTTAGTTATATGCTAGCTATATTTCTAGCTGGTTAAGATTTTAATACT
GCTTGCCATTCTTCTTCATTTATCATTTCGTCTCTTTCTTCTATATTTCCTTCCTCTTCA
AATTAACATAGTTAAATACTTCTTTAAAATTATTTGTTGGAATCAACAACTATTTGGAAC
CATTCTGCAATTAATGATGAATTCAGTAAATAAAGTCGATCAATAGTTATTAGGTCAATA
ATTATCTTGTTAAAAAATTTGTATTAAATTTAAGAGATAAAGAAAACATCATTTCCACTT
ATTAATTATTTCATCACTACTCTAGTAAACCACTTTATTTCGCTATTTTAACCTAATATC
AATATTGAAACTCTCTTTACAATCGATGTGATATTTCATTTATAATCTCTCTTTTTTACA
GTTCTTTTAGATTAGCTCCAAAATCAAGAAATAAAACTGCTTATATGGGATTTCATCTTA
AAAAATATTAATTCTTAATACAATTCATGTAAATAAATCTAATACCACTCCATATAATTT
ATAAACTCGTTCGCTCTTGCTGATTAAATGTCATTAATACAAAAAACTACCATAAACAGG
ATTATGAGAACTATAACACAAATTTTATAAGAAAAAGTGTAAAAGGATGTATTAGTTTCT
AGATAGCTTCTTCATTGTTTGCAGAACTGGATTTTCAATTTTAGATATTTTGAAATTAAC
TGCAGAAAACATTTTAAAGATGCAAAAAGGTTTTTAGAAAATTTAATTAAGGCTTTACAT
AATATATCTTAAATTAGTGACTTATAGTATGATGTATAATTCTTTTTGTCATAGTTGATG
AAAAATTACCTTGATTAAAGGTAAGATGATATGTTTAGCTTTTAACTTGAAGATTTAGTT
GAGCCTTAAAGTGATTTGCTTAGCCTAAAGAGTCGCGAATCTGTTTATCATACTATTAGC
TGCCATGAATCAATGAAGCAATAGCAAAAAATAATTTTTGAAATTTCTAAAATAGAAAAA
GATGTTCTCAAGTAAAAAACGCATTAAGCAACTTCTTTTGACTGCAGTGCATAGAGCCAA
TTAAATAACTCAAGCGTTTTAAAAAAGAGTTAACAAAATCAAGGAGTTGTATCATAAATT
AAAAAATACATAAAAAAGAACAGTAACCATTAATTTTAAGATATCAGCGAATATATACCT
GAATTTATAGAAAACAAGTATTTAAGCTTTTGTTTAGATAGTGAGAAACTTGTTTCTTTT
TTACTTGATAGCAAATCCTAAATATATGCAATTATCAGGGACCTTAATGGAAAATTTATT
TGGAAAGTAAGAGAAAAATTAGTTGAATCTCCTCTTTAAAAAGCTTTGAGATCAAACGAT
AAGTTAGATGATAATTAAATAAATCTAAATCAATAATAAAATCATTTTACACAATAAATA
AATTTAAACAATCATAATGAATTAGCCTAAAAGTAAAGTAAATCAGAAATTAAAGATAAA
AAGCCCTAACCAAATAATTAAAACTTGACTTAATATTTATAAGAAACTCACAAGTCAGAA
GGAAGTTTGATACATATGATTAAAAATCCACCTATTAATTGTGAAGAAAAACGTAAAGTA
AGTAAAGAAATTCCTAAACAAACTAAAAATGATTAATTATCAAAAATAATTGAATAAATA
ATCTACTTTATTCACGAACAAATTGTTTAAACTGAAAATGAAAGCTAATTTGGTGATGAT
GATGATCAAGAGTAAGAAGAAGAAAATATGCCTAGAAGCCCTTAAAAGAATGGAAACTTT
AATAAATAATTTACTTTAGCAAATAAACATGACCCAGTTTATCAAGAAACTGTAACAAGA
AGTTTAAAGTCTTTCATTTAAGAAGTTCCTTTCATGATAAAAGATAATAATAAATGCAAT
TTTATAGATCATCAATAGGATTCTTATTTAAACATAATAAGCTAGATTGATTAATATTCA
ACAAGCGACAAGGTTAAAATTGGGGTCTTATTCATGGGTAAGGACTAAGATAATGAATAA
TAAATATTATAAGCTTAATGTGGTAGCTAAAGATATGAGAGATTCTTAGAAAATCTAGGT
GAAAAAGTGAAATTGAGTGAGCATTAGGGCTTTTTAGGAGGATTAAGTCCAGATAGAGAC
GGTGAATACACAATATATAATCATTTTTATAACTGTGAGGTAGTTTACCATGTAGTCACT
ATGATGCCAATAAAAAATAAAGAAGATAAGCAATTTGTATCTAAGAAAAGACATATTGGA
AACGATTTTGTAAATATCATCTGGTGTGAAAATATCAGAAAATACTAGTAATACATCATA
CCAAGTTAGCTGACTACAGCATATATAGTAATACACCCTTTGACTAATAATTACTATAGA
ATTAATCTTATAAGAAAGGATAAATTAGGAGATTTCTTCTTTCCTTGGATAGATAAATCA
GTTATTCATGAGTAATTCTTAGATACTTTAGTAAAGATAGTATCTCTTTAAGCAAGTTAT
TGCGTTCAGCAGTATTAAGCAAGATATCACCAAAATCTACCTTAAAATATATTACGTCCT
TATAAGTCTCGTTAAAGTTTGATATTTTAGATACAAGAACAGCTTTCTATCCCATAAAAA
AGCAACATTCCAATTTCAGAATTATTTTCAATAAATTAGCCTTAACCATATATAGGGAAT
ACAAATTAAAATTAAAACTAAAAAAATACTAACTCCATAATACAGAATTAATCTTAAATT
AAAGTATCTAGCAATACAAATATCTCAAATAATATTGCTAATCGTTTAAAAATTTGA


>TTHERM_00194460(protein)
MSNTDDQETAIIKAFNASIEFILDKDKKTKHRFQQLVDVYKQIRDEGEQQNTSKDEQADS
QNQQNQHSSNQPVNQSQLNQSANNSSGVLNINGISMMKLQHRIIKNIKLNHIWHQSLNQN
YRVVYELIQDHLNKINPGFFQKLINQNNQCRDILQTLKLLYFFFDSLENVNIQELLKGVF
RLQIIQTIYCCLDYQNKEEARILGFILLFKIISSYDFNQLFRLQELSVLTLFNYIIDFQS
FSKPYSQNSIKDVCVFNSPSNGMPVWTNYIKDVSHEKSEKQYLDEIWKYMQLDVKNVRKW
LLIFSQTWFQLCFDKSYLKWSEEYFKRQDTVTKQYQMIYGLSTDQILLDQNTKINLTSSF
LKQINFFFVILSTNKKEKQKERRSTAVIADLRHKLLSEKEYMHYIDLLHSYFDKEEYYKI
ANDIISTFSDQMANFGDLFPVYYENDNIVLISSILMKIEESIIHEMTIRQNHQKKKQNFK
KENYQESHLQSHTKITPKRAEIYINCLQKLNHDQIRSTPYFKTFCTKVIKIGEDLLNEWM
QNKDQDQEQNSKVLIDLFFLLMSYQERIFLAQLEKSFRKEDSHKLLEENKLNSEDIILLR
EKMHQMSIELLNRYNVLKNLSDYVKNIAFKFIDTLYSQENLDIFQGEVVYLGNVLKKENQ
PYQLENTLQMILDVIKIRQKLQKEQRQSESVNNQINLHTMVVKERNLSQSQKSSASIESE
NNSNPLQKINYSNIEPQYKEKQDQKILQGVLKNYLNMGKLLNMEDVILLDEYIGNYSETN
TENKQEGTNPRNNNQQNLSFNRKRDNSNQQNLPKSDFSEVEQSEQNSNSSFVFVNASNEN
SETLFAQKKNIQFSEQINNVLQQEGNNSDSNEGSDFFRLGSQFLTKQEIDRNISRFIHSK
KSEAEESNDILEGALSCSKEESLNSSPKKNKSQNSKEKGQTSKINDLKNRRSSLYLKDEQ
QNKLEYLVIQFNNLMYKIDIICNNSNFVDLQNQNLSCKYTQQIIYCFLTPHQSQKHSNFL
NTSQSQASSSFNIQNKQKQSQIIRYPPSINTLFFIFYSYLNIQSKLETYQILQDLGNKQS
KIQKFATITNTAFIMKSFFQIYNKAHSQQNETLGEIVNQWEQLFNYCLNEDTDPIFSVAA
IVVNKDIFSTYPELMKHHSLIHKFLEKSKQILGYLIDPVSAPEDFSYMLAIFLAGQDFNT
ACHSSSFIISSLSSIFPSSSNQHSQILLQNYLLESTTIWNHSAINDEFSKQSRSIVIRSI
IILLKNLYQIQEIKKTSFPLINYFITTLVNHFISLFQPNINIETLFTIDVIFHLQSLFFT
VLLDQLQNQEIKLLIWDFILKNINSQYNSCKQIQYHSIQFINSFALADQMSLIQKTTINR
IMRTITQILQEKVQKDVLVSRQLLHCLQNWIFNFRYFEINCRKHFKDAKRFLENLIKALH
NISQISDLQYDVQFFLSQLMKNYLDQRQDDMFSFQLEDLVEPQSDLLSLKSRESVYHTIS
CHESMKQQQKIIFEISKIEKDVLKQKTHQATSFDCSAQSQLNNSSVLKKSQQNQGVVSQI
KKYIKKNSNHQFQDISEYIPEFIENKYLSFCLDSEKLVSFLLDSKSQIYAIIRDLNGKFI
WKVREKLVESPLQKALRSNDKLDDNQINLNQQQNHFTQQINLNNHNELAQKQSKSEIKDK
KPQPNNQNLTQYLQETHKSEGSLIHMIKNPPINCEEKRKVSKEIPKQTKNDQLSKIIEQI
IYFIHEQIVQTENESQFGDDDDQEQEEENMPRSPQKNGNFNKQFTLANKHDPVYQETVTR
SLKSFIQEVPFMIKDNNKCNFIDHQQDSYLNIISQIDQYSTSDKVKIGVLFMGKDQDNEQ
QILQAQCGSQRYERFLENLGEKVKLSEHQGFLGGLSPDRDGEYTIYNHFYNCEVVYHVVT
MMPIKNKEDKQFVSKKRHIGNDFVNIIWCENIRKYQQYIIPSQLTTAYIVIHPLTNNYYR
INLIRKDKLGDFFFPWIDKSVIHEQFLDTLVKIVSLQASYCVQQYQARYHQNLPQNILRP
YKSRQSLIFQIQEQLSIPQKSNIPISELFSINQPQPYIGNTNQNQNQKNTNSIIQNQSQI
KVSSNTNISNNIANRLKI


>TTHERM_00194460(gene)
ATGAGCAATACAGATGATTAGGAGACTGCTATAATAAAGGCTTTTAATGCAAGCATAGAA
TTTATTTTAGATAAAGATAAAAAAACAAAGCATAGATTTTAGTAGTTAGTGGATGTTTAT
AAACAAATCAGGGATGAAGGAGAGCAATAAAATACTAGCAAGGATGAATAAGCAGATAGT
CAGAATTAGTAAAATCAACACTCAAGCAACCAGCCAGTTAATTAGTCATAGTTGAATTAG
TCAGCTAATAACTCATCAGGAGTGCTTAATATTAACGGAATATCTATGATGAAATTGCAG
CATAGAATAATAAAGAATATCAAACTCAATCATATATGGCACTAGTCCTTGAATCAAAAT
TACAGGGTCGTTTATGAACTGATTTAAGATCATCTTAATAAAATTAATCCAGGCTTTTTT
TAAAAGCTAATTAATCAGAATAATTAATGTAGAGATATCCTTTAAACATTAAAGTTACTA
TATTTTTTCTTTGACAGTTTAGAAAATGTAAATATTCAAGAATTATTGAAAGGAGTCTTT
CGCTTGCAAATCATTCAAACCATTTACTGCTGTCTCGATTATTAAAATAAAGAAGAAGCA
AGAATTTTAGGTTTTATTCTCCTTTTTAAGATTATTTCTAGCTATGATTTCAATCAGCTA
TTTAGGCTACAAGAACTATCCGTTCTTACGCTATTCAATTATATAATAGATTTTTAGTCA
TTTAGCAAACCATACTCTTAAAACTCTATTAAAGATGTCTGCGTTTTTAACAGTCCGAGC
AATGGAATGCCTGTTTGGACAAATTATATTAAAGATGTAAGCCACGAAAAATCAGAAAAG
CAATATCTAGATGTAATTATGTTGATTCATTAGTTTTAGTTTCAAATTATCTATCAATAT
TGAACAAGCAATTAAACAAATATTAAGATATTTATCATGCTAAGCATTATCAAAAATTAG
GAAAAAAAATTATTTTAGATGAATAATGGATATTGAAATGTTAATTTACACTTTAAATAG
GAAAACACATAAAATTTATTTCCAAAACTATGATATTTTTATCTCAAATTTGTAATTACG
CAATAGTTTTTTTAATGATTTGCTATATTATTGTAATTTATTGGCTCTCAAAAAATACCA
CTAATTTTATGATATAGTAGTATTAAGTTGAATCAATAATAAATTATGTTAACGATACCG
AAATCAAAATCTAAATTTTATGAAATCTCAATAAGCAATACAATATGAAATTAAAATATA
TAAAAAACTAAGATAAAAATTTAATATTTTTGTTTTAATTTACTAAAAAATTAAATATTT
ATTTATTCATTCATTTAAAAATTTACTTTTAATTAGGAAATATGGAAATACATGCAATTG
GATGTTAAAAATGTGAGAAAGTGGTTGCTTATATTTTCTTAGACATGGTTTTAACTTTGT
TTTGATAAAAGTTACCTTAAATGGTCCGAAGAATATTTTAAGAGATAAGATACTGTTACC
AAGCAATATTAAATGATCTATGGTTTATCTACTGATTAAATTTTACTAGACTAAAATACT
AAAATAAATTTAACATCAAGCTTTCTTAAATAAATCAACTTTTTCTTTGTTATTCTTAGT
AATTATTAGCATTTTTCTGTTACGAAATTAAAAAATTTATTTTGTAAAAATTAGGCACTA
ATAAGAAGGAAAAGTAAAAAGAAAGAAGAAGCACAGCAGTTATTGCAGATTTAAGACACA
AATTACTTAGTGAAAAAGAGTATATGCACTATATAGATCTCCTACACAGCTATTTTGACA
AAGAAGAATATTATAAAATAGCAAATGATATAATAAGTACTTTTTCTGATCAAATGGCCA
ATTTTGGAGATCTTTTTCCTGTTTATTATGAAAATGACAACATTGTCTTAATATCTTCTA
TTCTAATGAAAATCGAAGAGAGTATAATACATGAGATGACTATCAGACAAAATCATTAGA
AAAAGAAATAAAATTTTAAAAAGGAAAATTATTAAGAATCCCATCTTTAAAGTCATACTA
AGATTACTCCAAAAAGAGCAGAAATTTACATAAACTGTTTATAAAAGTTAAATCATGATC
AAATACGCTCTACTCCTTACTTCAAAACATTCTGCACAAAAGTTATTAAAATAGGAGAGG
ACTTGTAAAATTTATTTTAATTTAAATGGGATTAAAAATTTTAACTTTATAATAAATAGA
TTAAATGAATGGATGTAAAATAAAGACTAGGACTAAGAATAAAACTCTAAAGTGCTGATT
GACTTGTTTTTCCTCTTGATGAGTTATTAGGAAAGAATCTTTTTAGCATAGCTTGAAAAA
TCATTCAGAAAAGAAGATTCTCATAAGCTGTTGGAAGAGAATAAGCTAAACAGCGAAGAT
ATCATTCTCTTGAGAGAGAAAATGCATCAAATGTCAATTGAATTATTAAACAGATACAAC
GTTTTAAAAAATTTAAGTGACTATGTTAAAAATATTGCTTTTAAATTTATTGATACACTC
TATTCTTAAGAGAATTTAGATATATTTTAAGGAGAAGTTGTTTATTTAGGAAATGTTTTG
AAAAAGGAAAATTAGCCATATTAGTTAGAAAATACTTTACAAATGATTTTAGATGTAATT
AAAATAAGGCAAAAACTTTAGAAAGAGTAAAGATAAAGTGAAAGTGTCAACAATTAAATA
AATTTACATACAATGGTTGTGAAGGAGAGAAATTTATCTTAATCTCAAAAAAGTTCTGCT
TCAATAGAATCAGAAAATAATTCTAATCCTCTATAAAAAATTAATTATTCAAATATAGAG
CCTCAATACAAAGAAAAGCAAGATTAAAAAATACTGTAAGGAGTTTTAAAAAATTATCTA
AACATGGGAAAATTACTTAATATGGAAGATGTTATTCTACTTGATGAGTATATAGGTAAT
TACAGTGAGACAAATACAGAAAATAAACAGGAAGGCACAAATCCTAGGAATAATAACCAA
TAAAACTTGTCCTTTAATAGGAAACGAGATAATTCAAATTAACAAAACCTTCCAAAATCG
GATTTTTCAGAGGTTGAACAAAGCGAATAAAATTCTAACAGCAGCTTCGTATTTGTGAAT
GCAAGCAATGAAAACAGTGAAACTTTATTTGCCTAAAAAAAGAATATTTAATTTAGTGAA
TAAATCAATAATGTTTTGTAGTAAGAAGGAAATAACTCTGATAGTAATGAAGGGAGCGAT
TTTTTTCGCTTAGGCAGCTAATTCTTGACAAAATAAGAAATTGATAGAAATATATCAAGG
TTCATTCATTCAAAAAAAAGTGAAGCAGAGGAATCTAACGATATATTGGAGGGTGCTTTA
AGCTGTTCGAAAGAAGAGTCACTAAATTCTTCTCCAAAGAAAAACAAATCATAGAATTCA
AAAGAAAAAGGATAAACTTCTAAAATAAATGATTTGAAAAATCGAAGATCATCTTTGTAT
TTAAAAGATGAATAACAAAATAAATTAGAGTATCTTGTTATTTAATTCAATAATTTGATG
TATAAAATAGATATAATTTGTAATAACTCAAATTTCGTAGATTTATAAAATCAGAACTTA
TCATGTAAATATACTCAGTAAATAATCTATTGCTTCTTGACTCCTCACTAGAGCTAAAAG
CATTCTAATTTCTTAAATACTAGTTAAAGTCAAGCTTCTAGTTCTTTTAATATCTAAAAT
AAATAAAAACAATCATAAATAATAAGATATCCTCCATCAATAAATACTTTATTTTTTATA
TTTTACAGTTATTTAAATATACAAAGTAAGTTAGAAACTTATTAGATCTTGTAAGATTTA
GGTAACAAGCAATCAAAAATATAAAAATTTGCTACAATCACAAATACAGCTTTTATTATG
AAATCCTTTTTTCAAATATACAACAAAGCTCATTCTTAACAAAACGAAACCTTAGGAGAG
ATAGTTAATCAATGGGAATAACTCTTTAATTATTGTCTTAACGAAGACACAGATCCAATC
GTAAATTATCCAATTAAATATAAAAATATAATTAATAATTTATATTATTTAAAAACAGTT
TAGCGTGGCAGCAATTGTAGTGAATAAAGATATTTTTTCAACTTATCCTGAATTAATGAA
ACATCACAGCTTGATTCATAAATTTTTAGAGAAATCAAAGTAAATTTTAGGATATTTGAT
AGACCCTGTTTCAGCACCTGAAGATTTTAGTTATATGCTAGCTATATTTCTAGCTGGTTA
AGATTTTAATACTGCTTGCCATTCTTCTTCATTTATCATTTCGTCTCTTTCTTCTATATT
TCCTTCCTCTTCAAATTAACATAGTTAAATACTTCTTTAAAATTATTTGTTGGAATCAAC
AACTATTTGGAACCATTCTGCAATTAATGATGAATTCAGTAAATAAAGTCGATCAATAGT
TATTAGGTCAATAATTATCTTGTTAAAAAATTTGTATTAAATTTAAGAGATAAAGAAAAC
ATCATTTCCACTTATTAATTATTTCATCACTACTCTAGTAAACCACTTTATTTCGCTATT
TTAACCTAATATCAATATTGAAACTCTCTTTACAATCGATGTGATATTTCATTTATAATC
TCTCTTTTTTACAGTTCTTTTAGATTAGCTCCAAAATCAAGAAATAAAAGTATAAAATTT
TTTATTAATTATTTTAAAACTAATTTTTTGAATTATTTTAAAACAGCTGCTTATATGGGA
TTTCATCTTAAAAAATATTAATTCTTAATACAATTCATGTAAATAAATCTAATACCACTC
CATATAATTTATAAACTCGTTCGCTCTTGCTGATTAAATGTCATTAATACAAAAAACTAC
CATAAACAGGATTATGAGAACTATAACACAAATTTTATAAGAAAAAGTGTAAAAGGATGT
ATTAGTTTCTAGATAGCTTCTTCATTGTTTGCAGGTAAATTTATTAAATATAAGATTACA
ATTATAGTAAATTTATTTAATTAAAAGAACTGGATTTTCAATTTTAGATATTTTGAAATT
AACTGCAGAAAACATTTTAAAGATGCAAAAAGGTTTTTAGAAAATTTAATTAAGGCTTTA
CATAATATATCTTAAATTAGTGACTTATAGTATGATGTATAATTCTTTTTGTCATAGTTG
ATGAAAAATTACCTTGATTAAAGGTAAGATGATATGTTTAGCTTTTAACTTGAAGATTTA
GTTGAGCCTTAAAGTGATTTGCTTAGCCTAAAGAGTCGCGAATCTGTTTATCATACTATT
AGCTGCCATGAATCAATGAAGCAATAGCAAAAAATAATTTTTGAAATTTCTAAAATAGAA
AAAGATGTTCTCAAGTAAAAAACGCATTAAGCAACTTCTTTTGACTGCAGTGCATAGAGC
CAATTAAATAACTCAAGCGTTTTAAAAAAGAGTTAACAAAATCAAGGAGTTGTATCATAA
ATTAAAAAATACATAAAAAAGAACAGTAACCATTAATTTTAAGATATCAGCGAATATATA
CCTGAATTTATAGAAAACAAGTATTTAAGCTTTTGTTTAGATAGTGAGAAACTTGTTTCT
TTTTTACTTGATAGCAAATCCTAAATATATGCAATTATCAGGGACCTTAATGGAAAATTT
ATTTGGAAAGTAAGAGAAAAATTAGTTGAATCTCCTCTTTAAAAAGCTTTGAGATCAAAC
GATAAGTTAGATGATAATTAAATAAATCTAAATCAATAATAAAATCATTTTACACAATAA
ATAAATTTAAACAATCATAATGAATTAGCCTAAAAGTAAAGTAAATCAGAAATTAAAGAT
AAAAAGCCCTAACCAAATAATTAAAACTTGACTTAATATTTATAAGAAACTCACAAGTCA
GAAGGAAGTTTGATACATATGATTAAAAATCCACCTATTAATTGTGAAGAAAAACGTAAA
GTAAGTAAAGAAATTCCTAAACAAACTAAAAATGATTAATTATCAAAAATAATTGAATAA
ATAATCTACTTTATTCACGAACAAATTGTTTAAACTGAAAATGAAGTAATTTATTTTTTT
ATTTGATAAACATTCCAAAAATTCAATAAAAATTTTGTTAAAAAACCTTTCTATCAAATT
AAATAATTAAATTGATTAAAATTGCTCATTGGTTCATATTATTATAACATTTTCAACAAT
ATAATTAGAGCTAATTTGGTGATGATGATGATCAAGAGTAAGAAGAAGAAAATATGCCTA
GAAGCCCTTAAAAGAATGGAAACTTTAAGTAAATTAGAAAATTTGTATTTTATTAATTAG
TTTGAAATTTTTTTTTTCAGTAAATAATTTACTTTAGCAAATAAACATGACCCAGTTTAT
CAAGAAACTGTAACAAGAAGTTTAAAGTCTTTCATTTAAGAAGTTCCTTTCATGATAAAA
GATAATAATAAATGCAATTTTATAGATCATCAATAGGATTCTTATTTAAACATAATAAGC
TAGATTGATTAATATTCAAGTAAATATTTTTTAAAATACTTAACAATTTTACATTTTAAA
TCTAAAAAATTAGCAAGCGACAAGGTTAAAATTGGGGTCTTATTCATGGGTAAGGACTAA
GATAATGAATAATAAATATTATAAGCTTAATGTGGTAGCTAAAGATATGAGAGATTCTTA
GAAAATCTAGGTGAAAAAGTGAAATTGAGTGAGCATTAGGGCTTTTTAGGAGGATTAAGT
CCAGATAGAGACGGTGAATACACAATATATAATCATTTTTATAACTGTGAGGTAGTTTAC
CATGTAGTCACTATGATGCCAATAAAAAATAAAGAAGATAAGCAATTTGTATCTAAGAAA
AGACATATTGGAAACGATTTTGTAAATATCATCTGGTGTGAAAATATCAGAAAATACTAG
TAAAAATAATTTATAAATTTTTATAATTCAATCAAATTAAACATTTATATAGGTAATACA
TCATACCAAGTTAGCTGACTACAGCATATATAGTAATACACCCTTTGACTAATAATTACT
ATAGAATTAATCTTATAAGAAAGGATAAAGTAATTTGCTTTTTGAATGAAACTAACCAAT
AATAAATAATTTTTACTAAACAAATTAAAAATAGTTAGGAGATTTCTTCTTTCCTTGGAT
AGATAAATCAGTTATTCATGAGTAATTCTTAGATACTTTAGTAAAGATAGTATCTCTTTA
AGCAAGTTATTGCGTTCAGCAGTATTGTAAGCATTCATTCATATTTATTTTAACAATTAA
ACATTAATTTTTTATACCTTTACCAATTTTAGAAGCAAGATATCACCAAAATCTACCTTA
AAATATATTACGTCCTTATAAGTCTCGTTAAAGTTTGATATTTTAGATACAAGAACAGCT
TTCTATCCCATAAAAAAGCAACATTCCAATTTCAGAATTATTTTCAATAAATTAGCCTTA
ACCATATATAGGGAATACAAATTAAAATTAAAACTAAAAAAATACTAACTCCATAATACA
GAATTAATCTTAAATTAAAGTATCTAGCAATACAAATATCTCAAATAATATTGCTAATCG
TTTAAAAATTTGA