Identifiers and Description

Gene Model Identifier

TTHERM_00614720

Standard Name

RAB5C (Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events)

Aliases

PreTt19120 | 85.m00113 | 3725.m00006

Description

small GTP-binding protein domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( PF00009 ) Elongation factor Tu GTP binding

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00614720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21122.15.001897638882051e-133small GTP-binding protein doma
in-containing protein (205 aa)
OxytrichaContig16543.0.g1071.0002546821282671e-50Ras family
SGDYKR014C2.99915080840225e-45YPT52 Rab family GTPase, simil
ar to Ypt51p and Ypt53p and to
mammalian rab5; required for
vacuolar protein sorting and e
ndocytosis
DictyBaseDDB_G02719849.001612426253082e-40rab5A on chromosome: 2 positio
n 1113320 to 1114208
WormBaseWBGene000042684.001416569413617e-37locus:rab-5 status:Partially
_confirmed UniProt:P91857
protein_id:CAB04205.1
Stentor CoeruleusSteCoe_365177.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00614720(coding)
ATGGGAAACGTATGCGGAGGATCTTCACAATCATCATCTAGTAGTAAAAGCTAGAGAGCA
TTAAGATTAAGGGATGAAAAAAAACCAGCATAATAGGCAAAAGTAGTATTATTAGGAAAT
ATAGCAGTAGGAAAAACTGCAATCACTCAAAGATTTAAATAAGGAATATTTGATCCAGCC
CACCAAGCAACATTAGGAGCAGCATACATAGAAAAAAATATTACATTATAAGATAATTCC
GTTTTGTCTTTGCATATTTGGGATACAGCAGGAGATGAAAGATATCGCTCAATCCTTTCC
ATGTTTTATAGAGATTCTTAGGCAGCCATTTTAGTTTATGATGTGACTGATGCAGATAGT
TTCAATAGTTTGTAATTATGGATAAACGAGCTTGAAGATAAAGCAAAAACAGAAGGCATG
ATTATAGCTCTAGTTGGTAATAAAATAGATTCACCTTATGAAATGGTAAAAGTTTCAACA
TAGAAGGCAGAGCAATTTGCTAGAGAGAAAAACTTCTTGTTTACTGAGTGTTCAGCCAAA
ACAGGAGAAGGAATAGATAGAATATTTAATATGATAGTTGAAGAATTAATAAAAAAGAAA
AAATCAGAGCATAACTGA


>TTHERM_00614720(protein)
MGNVCGGSSQSSSSSKSQRALRLRDEKKPAQQAKVVLLGNIAVGKTAITQRFKQGIFDPA
HQATLGAAYIEKNITLQDNSVLSLHIWDTAGDERYRSILSMFYRDSQAAILVYDVTDADS
FNSLQLWINELEDKAKTEGMIIALVGNKIDSPYEMVKVSTQKAEQFAREKNFLFTECSAK
TGEGIDRIFNMIVEELIKKKKSEHN


>TTHERM_00614720(gene)
ATGGGAAACGTATGCGGAGGATCTTCACAATCATCATCTAGTAGTAAAAGCTAGAGAGCA
TTAAGATTAAGGGATGAAAAAAAACCAGCATAATAGGCAAAAGTAGTATTATTAGGAAAT
ATAGCAGTAGGTATTCAATTAAAATAGCAACTAGAATTAATTTTAAACAGCTATTTTAGC
AGTTTTAGTTTGAAACATTTTTTATAGAATATATTTAATCTAATATAAAGGAAAAACTGC
AATCACTCAAAGATTTAAATAAGGAATATTTGATCCAGCCCACCAAGCAACATTAGGAGC
AGCATACATAGAAAAAAATATTACATTATAAGATAATTCCGTTTTGTCTTTGCATATTTG
GGATACAGCAGGAGATGAAAGATATCGTAAATTATTAATCATTTTTAACTTTTACTTAAA
CCAGAACAAAAAAATTGTTGAACTTTATCATTTTACACGTTTTTATCGGTTTTATTGATT
TGTTTAATAAATTTTCAAAAATATATGTAAAATATTAACAATATTTTCTAAAAAAAAAAT
AGGCTCAATCCTTTCCATGTAAATTTTAATTCTCAATATTTTGTGGAAGCCAAAGTAAGT
AAAAATACGAAATGGGCTTTGATTATTTTAAAAGAGCGAGAAAGAGATTTTATGTAATAA
TAAAAATAATTAAATTTATAGGTTTTATAGAGATTCTTAGGCAGCCATTTTAGTTTATGA
TGTGACTGATGCAGATAGTTTCAATAGTTTGTAATTATGGATAAACGAGCTTGAAGATAA
AGCAAAAACAGAAGGCATGATTATAGCTCTAGTTGGTAATAAAATAGATTCACCTTATGA
AATGGTAAAAGTTTCAACATAGAAGGCAGAGCAATTTGCTAGAGAGAAAAACTTCTTGTT
TACTGAGTGTTCAGCCAAAACAGGAGAAGGAATAGATAGAATATTTAATATGATAGTTGA
AGAATTAATAAAAAAGAAAAAATCAGAGCATAACTGA