Identifiers and Description

Gene Model Identifier

TTHERM_00334520

Standard Name

RAB5B

Aliases

PreTt05997 | 34.m00234 | 3689.m00032

Description

Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00334520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16044.16.001241942754875e-123small GTP-binding protein doma
in-containing protein (205 aa)
OxytrichaContig22448.0.g394.998711177326993e-55Ras family
WormBaseWBGene000042682.998863950472602e-38locus:rab-5 status:Partially
_confirmed UniProt:P91857
protein_id:CAB04205.1
SGDYOR089C2.998863950472602e-38VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
DictyBaseDDB_G02898273.0001084582952455e-37rab18 on chromosome: 5 positio
n 3292859 to 3293559
Stentor CoeruleusSteCoe_286771.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00334520(coding)
ATGAGTAAAAAATAGAATAAAGATAGTGGAGGTGGTTGCTGTGGCGGCAGTAGCAGCTCA
AACAATTCAGTATAAAAGCCATTAAATACAAAAAAAAAAGAAATTAAGGTAGTATTATTA
GGTGACCCTAATGTAGGAAAAAGTTCTATTGCGTTGAGATATTGCAAGCATTAATTTAGT
GAAACATATGAGCTCACAATAGGAGGTGTTTATAATTTAAAAGAGACTACATTATCTAAC
GGATAAAAAGTTGCAATTCACCTTTGGGATACTGGTGGTGAAGAAAAATTTAGATCAATG
ACCCAGTTATATTATAATGACGCTTAAGCAGCTATTTTAGTTTATGATGTCTAAAATGCA
TAAACATTTTAAAGTTTAGAGTATTGGTTAAAAGAATTAGAAAATAAAGTTTCTAATTAA
GGAATGATATTGTGTATAGCTGGAAATAAATGTGATGTGGATGAAGATTTGAGAGCTGTA
ACCTACGATTAAGGAGCTTAATTTTGTAAAAATAATAATAATATAATATTTGCTGAAACA
TCAGCAAAAACAAATTAAGGAATTGATGACCTCTTTAATGAATTGTTAGAAAAGATATAA
AATAAACTATGA


>TTHERM_00334520(protein)
MSKKQNKDSGGGCCGGSSSSNNSVQKPLNTKKKEIKVVLLGDPNVGKSSIALRYCKHQFS
ETYELTIGGVYNLKETTLSNGQKVAIHLWDTGGEEKFRSMTQLYYNDAQAAILVYDVQNA
QTFQSLEYWLKELENKVSNQGMILCIAGNKCDVDEDLRAVTYDQGAQFCKNNNNIIFAET
SAKTNQGIDDLFNELLEKIQNKL


>TTHERM_00334520(gene)
ATGAGTAAAAAATAGAATAAAGATAGTGGAGGTGGTTGCTGTGGCGGCAGTAGCAGCTCA
AACAATTCAGTATAAAAGCCATTAAATACAAAAAAAAAAGAAATTAAGGTAGTATTATTA
GGTGACCCTAATGTAGGAAAAAGTTCTATTGCGTTGAGATATTGCAAGCATTAATTTAGT
GAAACATATGAGCTCACAATAGGAGGTGTTTATAATTTAAAAGAGACTACATTATCTAAC
GGATAAAAAGTTGCAATTCACCTTTGGGATACTGGTGGTGAAGAAAAATTTAGGTAAAAT
TTATTTTGCTTTCCAAATTATTAATAACAAACAGACACACACAGTAAAATGAAATAACAG
AATAAAATGTTATATTGCTGAAAATTTATTACAAATTTAATTTAAGAAAGTAAAAAATAT
AAAATAAATTTAAATAGATCAATGACCCAGTTATATTATAATGACGCTTAAGCAGCTATT
TTAGTTTATGATGTCTAAAATGCATAAACATTTTAAAGTTTAGAGTATTGGTTAAAAGAA
TTAGAAAATAAAGTTTCTAATTAAGGAATGATATTGTGTATAGCTGGAAATAAATGTGAT
GTGGATGAAGATTTGAGAGCTGTAACCTACGATTAAGGAGCTTAATTTTGTAAAAATAAT
AATAATATAATATTTGCTGAAACATCAGCAAAAACAAATTAAGGAATTGATGACCTCTTT
AATGAATTGTTAGAAAAGATATAAAATAAACTATGA