Identifiers and Description

Gene Model Identifier

TTHERM_00107200

Standard Name

RAB56

Aliases

PreTt23112 | 7.m00561

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02528 ) ethanolamine utilization protein, EutP
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00107200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig1379.1.g498.999890565246037e-26Ras family
WormBaseWBGene000042722.0009605191578312e-25locus:rab-8 status:Confirmed
UniProt:G5EFC1 protein_id
:CCD68351.1
Tetrahymena borealisEI9_04971.16.998020510507768e-25Ras-like protein Rab11 (207 aa
)
DictyBaseDDB_G02924062.000620012690291e-23rab4 on chromosome: 6 position
1558648 to 1559514
SGDYER031C3.9983110956465888e-22YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00107200(coding)
ATGAGTAGCAACACTTCGTCTTTCAGTCTTTTAGATGAAGTAGAATTAAATGAGCATAGT
AAGCTTAGATTCATTCAAAAAATGAACATCGCGTTACTGGGGAATTCAGGAGTTGGAAAA
ACCTGCATTATTTAATAATATTGTAAAAATGAATTTAGAGATTTAACAGCTATGACATGC
TGCATAGATTTTGCTAAAAAATAATTTGAAGATTTTCTTTTATGCGTTTTTGATACAGCT
GGAAGTGAGAGGTACAGAGGCCTTGCTACTAGTTACCTAAAAAATCAACATGCTGTGATT
ATAGTTTATGATGTTACAGACCCGAAATCAAAAAGAGATGTAATTAACTGGAAGAATATC
GCTGAATCCTTCTCTCCAAGCATTCCAATAATAATTATTGGAAATAAAGTTGATTTAATT
TCTAACGAAGAGCTCAAAAGCATGCAGCAAGAACAAAATGCTTATATCTTTAATAAGACT
TTTTTTACTTCTGCTTTACTAAACTAAGGTCTAGATGATGCATTTAACTACATCATAAAT
CAGGCTAAAAATAAATTAAATCAAAGTGTAATTTGCTCACCTAAAAAATTCAAAAAAAAC
ATTAAAAATGATGAAAATCAAAAAAAAAATGCAAATAATTGCAAATGCTGA


>TTHERM_00107200(protein)
MSSNTSSFSLLDEVELNEHSKLRFIQKMNIALLGNSGVGKTCIIQQYCKNEFRDLTAMTC
CIDFAKKQFEDFLLCVFDTAGSERYRGLATSYLKNQHAVIIVYDVTDPKSKRDVINWKNI
AESFSPSIPIIIIGNKVDLISNEELKSMQQEQNAYIFNKTFFTSALLNQGLDDAFNYIIN
QAKNKLNQSVICSPKKFKKNIKNDENQKKNANNCKC


>TTHERM_00107200(gene)
ATGAGTAGCAACACTTCGTCTTTCAGTCTTTTAGATGAAGGTATGAATTAAATAAATAAA
ATCAGTTTAGCAAAAACTGTTTTCAAGAAGAATAAAAGCAAAACATTTTAAATTGAAGGT
CATATTGAGTTTATATAAAAATATATATTCTAAAACATAAAAAAATTGCTCTAATATTGC
CTGATTTGTTTGTTTTAATATTTTAAATTGTAACATATGAAATATTTTTATATCGTTTTA
TATTAAAATATAAATAGTAGAATTAAATGAGCATAGTAAGCTTAGATTCATTCAAAAAAT
GAACATCGCGTTACTGGGGAATTCAGGTAGATATTTTATTATAGTTGCAGTTTTTGAAAA
AAATTAGTAAATTGGATTGACTAGCTTACTAGAAATTTATCTGTTATTTACTCATATAAT
ATTATTAATTTAAAAGGAGTTGGAAAAACCTGCATTATTTAATAATATTGTAAAAATGAA
TTTAGAGATTTAACAGCTATGACATGCTGCATAGATTTTGCTAAAAAATAATTTGAAGAT
TTTCTTTTATGCGTTTTTGATACAGTAATTTTTTTATCTATTTTTTTAAAATAATTTAAA
ACTTCTTTCATAGCTAATTAAATTTAAAAATAAATAGGCTGGAAGTGAGAGGTACAGAGG
CCTTGCTACTAGTTACCTAAAAAAGTAATAAATATTTCTTAATTTTCAAAATATTTATTT
TATCATAAAAGCCTAAAAAACAAATATCATAAATAAGTGAGTAAACTGATAATTAATAAA
TGATTTTCTCCTATAAAAAGCTTTGAATTGTTCATTTAACACTTGAATTATTAGTTATGA
ATTTTTTTATTGAAAAAGTCAACATGCTGTGATTATAGTTTATGATGTTACAGACCCGAA
ATCAAAAAGAGATGTAATTAACTGGAAGAATATCGCTGAATCCTTCTCTCCAAGCATTCC
AATAATAATTATTGGAAATAAAGTTGATTTAATTTCTAAGTAAATTCATGATTATCTAAA
GTAGATAGATAGAATATATAATTATTTTATTTAATATTAAAAATAGCGAAGAGCTCAAAA
GCATGCAGCAAGAACAAAATGCTTATATCTTTAATAAGACTTTTTTTACTTCTGCTTTAC
TAAACTAAGGTCTAGATGATGCATTTAACTACATCATAAATCAGGCTAAAAATAAATTAA
ATCAAAGTGTAATTTGCTCACCTAAAAAATTCAAAAAAAACATTAAAAATGATGAAAATC
AAAAAAAAAATGCAAATAATTGCAAATGCTGA