Identifiers and Description

Gene Model Identifier

TTHERM_00024230

Standard Name

RAB52 (RAB GTPase 52)

Aliases

PreTt12036 | 1.m01084

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_00024230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
SGDYFL038C1.0004783691736523e-35YPT1 Rab family GTPase, involv
ed in the ER-to-Golgi step of
the secretory pathway; complex
formation with the Rab escort
protein Mrs6p is required for
prenylation of Ypt1p by prote
in geranylgeranyltransferase t
ype II (Bet2p-Bet4p)
OxytrichaContig11247.0.g572.0003218023735366e-33Ras family
Tetrahymena borealisEI9_18305.19.99723014177113e-33Ras family protein (212 aa)
DictyBaseDDB_G02849853.999374135750469e-31rab1D on chromosome: 4 positio
n 2756032 to 2757408
WormBaseWBGene000042732.0008113830639685e-30locus:rab-10 status:Confirme
d UniProt:Q94148 protein_i
d:CCD70773.1
Stentor CoeruleusSteCoe_249850.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00024230(coding)
ATGAGTAAGGTAGCAAATAGCAATGATAATAAAATACGCATTCTTTTTTGTGGAAATATA
AATGTTGGTAAGTCATGTATAATTTAAAGGTTAATTACCAATAATTTTATAGAAAACTAC
ACTCCTACAGTTGGAGTTGACTTTAGATCAATATATTATTAAATTAATTAAACAAAGGTC
TAAGTCAATCTATTAGATATTCCTGGATAGGATAGATATAATGCATTAACACTGTCTTAA
ATAAGAAATGTAGATGGAGTTGTCTTTGTCTATGATATTTCTGACATGGATTCTTTCACA
GATATTATAAATTGGTAATAAAAAATTTAAAGTGCAGCTCATGAAAATACTTTTTAAACT
CTTCTTGGAAATAAATGTGATTTATTAGATAGATAGGTGCCTTTCAATAAAGGATTAGAA
TTTGCAGAGTCTAAAAGTATGAATTTCTTTGAGACCTCAGCTAAAAATGGTAAAGATGTA
GTAAATTCAGTTCAGAGTTTAGCTCAAAAAATATTTTGTGAAAGGTTGATGAATTAAAAT
TAATAAAAAAATGATGAGAATGGCACAGTTAAGCTTTAAAAATCGAAACTAACCTTTCTA
AATTTTTTTAAGGGTGCTTATAATTACTATTGTTGA


>TTHERM_00024230(protein)
MSKVANSNDNKIRILFCGNINVGKSCIIQRLITNNFIENYTPTVGVDFRSIYYQINQTKV
QVNLLDIPGQDRYNALTLSQIRNVDGVVFVYDISDMDSFTDIINWQQKIQSAAHENTFQT
LLGNKCDLLDRQVPFNKGLEFAESKSMNFFETSAKNGKDVVNSVQSLAQKIFCERLMNQN
QQKNDENGTVKLQKSKLTFLNFFKGAYNYYC


>TTHERM_00024230(gene)
ATGAGTAAGGTAGCAAATAGCAATGATAATAAAATACGCATTCTTTTTTGTGGAAATATA
AATGTTGGTAAGTCATGTATAATTTAAAGGTTAATTACCAATAATTTTATAGAAAACTAC
ACTCCTACAGTTGGAGTTGACTTTAGATCAATATATTATTAAATTAATTAAACAAAGGTC
TAAGTCAATCTATTAGATATTCCTGGATAGGATAGATATAATGCATTAACACTGTCTTAA
ATAAGAAATGTAGATGGAGTTGTCTTTGTCTATGATATTTCTGACATGGATTCTTTCACA
GATATTATAAATTGGTAATAAAAAATTTAAAGTGCAGCTCATGAAAATACTTTTTAAACT
CTTCTTGGAAATAAATGTGATTTATTAGATAGATAGGTGCCTTTCAATAAAGGATTAGAA
TTTGCAGAGTCTAAAAGTATGAATTTCTTTGAGACCTCAGCTAAAAATGGTAAAGATGTA
GTAAATTCAGTTCAGAGTTTAGCTCAAAAAATATTTTGTGAAAGGTTGATGAATTAAAAT
TAATAAAAAAATGATGAGAATGGCACAGTTAAGCTTTAAAAATCGAAACTAACCTTTCTA
AATTTTTTTAAGGGTGCTTATAATTACTATTGTTGA